Align gluconate:H+ symporter (gntT) (characterized)
to candidate BWI76_RS27855 BWI76_RS27855 D-serine transporter DsdX
Query= reanno::Cup4G11:RR42_RS28835 (453 letters) >FitnessBrowser__Koxy:BWI76_RS27855 Length = 445 Score = 323 bits (827), Expect = 9e-93 Identities = 173/445 (38%), Positives = 264/445 (59%), Gaps = 16/445 (3%) Query: 14 LIAVIALVVLIAKFKLNPFITLVVVSVLLGFAVGMPMGDIVKSFEAGVGGTLGHIALVVG 73 LI+++ +V+ I K K +PF+ L++ S +G +GM D+V + E+G+GGTLG +A V+G Sbjct: 12 LISIVLIVLTIVKLKFHPFLALLLASFFVGAMMGMSPLDMVNAIESGIGGTLGFLAAVIG 71 Query: 74 LGTMLGKMMAESGGAERIARTLIDAFGEKNVHWA-----MVTIAFIVGLPVFFEVGFVLL 128 LGT+LGKMM SG AERI TL + W MV + I G+ +F EVG VLL Sbjct: 72 LGTILGKMMEVSGAAERIGLTL------QRCRWLSADVIMVLVGLICGITLFVEVGVVLL 125 Query: 129 VPIAFNVAKRTGTSMVLVGIPMVAGLSVVHGLIPPHPAALLAVTAYKADIGKTILYALIV 188 +P+AF++AK+T TS++ + IP+ L VH ++PPHPAAL ADIG I+Y L+V Sbjct: 126 IPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPAALFVANKLGADIGTVIVYGLLV 185 Query: 189 GIPTAAIAGPLFAKLMTRYVTLPDVNPLAAQFTEEDEGVKASHELPGFGITLFTILLPVI 248 G+ + + GPLF +L+ + V A+F + V+ LP G TLFT+LLP+ Sbjct: 186 GLLASLVGGPLFLRLLGNRLPFKAV---PAEFANLE--VRKEETLPSLGATLFTVLLPIG 240 Query: 249 LMLIGSWADLITTPKTFANDFLKLIGNSVIALLIAALVSFYTFGKRRGFTRENILRFTNE 308 LML+ + A+L T L+ IGN + A+ IA V++Y G R+ +L T Sbjct: 241 LMLVKTIAELNMTKGGTLYMLLEFIGNPITAMFIAVFVAYYVLGIRQDMGMSTLLTHTEN 300 Query: 309 CVAPTAIITLVVGAGGGFGRVLRDSGISNAIVDVATGAHVSVLLLGWLVAVLIRIATGSA 368 C A I L++GAGG F +L+ SG+++ + + + + +LL WLVA+++ A GSA Sbjct: 301 CFGSIANILLIIGAGGAFNAILKTSGLADTLAVILSNLDMHPILLAWLVALILHAAVGSA 360 Query: 369 TVAMTTAAGIVAPIAASVPGTRPELLVLTTGAGSLILSHVNDGGFWLVKEYFNMTVAQTF 428 TVAM A IVAP+ PG PE++ + G+G++ + V D FWLVK+Y ++ +TF Sbjct: 361 TVAMMGATAIVAPMLPLYPGVSPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGASLNETF 420 Query: 429 KTWSVCETLISVIALLLTLALATVV 453 K ++ + S++AL T L+ ++ Sbjct: 421 KYYTTATFIASLLALAGTFLLSFII 445 Lambda K H 0.326 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 579 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 445 Length adjustment: 33 Effective length of query: 420 Effective length of database: 412 Effective search space: 173040 Effective search space used: 173040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory