Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate BWI76_RS26540 BWI76_RS26540 D-isomer specific 2-hydroxyacid dehydrogenase family protein
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Koxy:BWI76_RS26540 Length = 317 Score = 155 bits (392), Expect = 1e-42 Identities = 100/308 (32%), Positives = 157/308 (50%), Gaps = 17/308 (5%) Query: 10 LPEDVLA----YLQQHA-QVVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLK 64 LP++++A YL+ Q++ + + + + D DG I K++ + E A +LK Sbjct: 7 LPQEIMAEGREYLESRGYQLINGSGMEEEDIIRDIGDCDGIIVRLSKMSDRVFEAAKKLK 66 Query: 65 ALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAE-WVKA 123 ++ G+D D+ R G+V+ N P + S A+ +L +R + E ++ Sbjct: 67 VVARHGAGYDTVDLESAKRHGVVVLNAPIANSMSVAELAIFYMLHCSRNFKLVQEKMLED 126 Query: 124 GHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAY 183 +W P V++ GKTLG++G+G IG VA +A GFNMKV+ + +P + Sbjct: 127 YYWAKLRTPK---VELDGKTLGLIGVGNIGSRVAIKALHGFNMKVI----AYDPYKTQQQ 179 Query: 184 GARRVELAE----LLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDE 239 VEL + + +DFV L P T ET +G + MK SA IN +RG VDE Sbjct: 180 IPEGVELTDDFDRIFTESDFVSLHCPTTAETTDFVGEKQFSMMKPSAYFINTARGKLVDE 239 Query: 240 KALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAAE 299 KAL AL I GAG+DV + EP ++ P+ L+N+V PHIG+AT E + ++A Sbjct: 240 KALYHALSTHAIAGAGVDVLKKEPFDANDPIFSLSNIVIAPHIGAATIEATDRASLHSAI 299 Query: 300 NLVAALDG 307 + L G Sbjct: 300 GIDEVLSG 307 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 317 Length adjustment: 28 Effective length of query: 293 Effective length of database: 289 Effective search space: 84677 Effective search space used: 84677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory