Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate BWI76_RS10370 BWI76_RS10370 ABC transporter-like protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >FitnessBrowser__Koxy:BWI76_RS10370 Length = 259 Score = 254 bits (650), Expect = 1e-72 Identities = 127/248 (51%), Positives = 176/248 (70%), Gaps = 1/248 (0%) Query: 13 QALLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQI 72 + ++ IR LHK++G VL+G+DL + G + +IG SGSGK+TLLRC+N +E G + Sbjct: 5 KVVMRIRALHKRFGAQSVLQGIDLDIYAGEKIAIIGGSGSGKSTLLRCLNFMEIPSAGTV 64 Query: 73 LLDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKL 132 LDG ++G + G+R R+SEK ++ R GM FQQFNLFPHLT LQNV+ L+ VKK+ Sbjct: 65 ELDGVTLGKIDSRGQR-RYSEKQLSDVRQRVGMVFQQFNLFPHLTVLQNVSEALISVKKM 123 Query: 133 HKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALD 192 ++EA+ +A LE+VGL + +PG LSGGQQQRVAIARA+AM P ++LFDE TS+LD Sbjct: 124 RREEAMRIARAQLEKVGLGHKHQAWPGSLSGGQQQRVAIARALAMTPEIILFDEPTSSLD 183 Query: 193 PELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQ 252 PELVGEVL I+ LA++G T+LLVTHE+ FA+ +D+++F+ G I E G +E+ P+ Sbjct: 184 PELVGEVLHTIRELADEGRTLLLVTHELGFAWHFADRVIFIENGVIHEMGTAEEVLRHPR 243 Query: 253 SPRLAEFL 260 PR FL Sbjct: 244 QPRTQAFL 251 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 259 Length adjustment: 25 Effective length of query: 240 Effective length of database: 234 Effective search space: 56160 Effective search space used: 56160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory