Align N-acetyl-D-glucosamine kinase; EC 2.7.1.59; GlcNAc kinase (uncharacterized)
to candidate BWI76_RS22415 BWI76_RS22415 transcriptional regulator
Query= curated2:Q9KRV2 (302 letters) >FitnessBrowser__Koxy:BWI76_RS22415 Length = 304 Score = 193 bits (491), Expect = 4e-54 Identities = 110/301 (36%), Positives = 165/301 (54%), Gaps = 7/301 (2%) Query: 1 MYYGFDVGGTKIEFGAFNEQLERVATERVATPTDDYAKLVETIAGLVHKYDAQFGVEGTV 60 ++ G D+GGTK+E N E V +R T + Y ++ + GL+ A T+ Sbjct: 2 LHLGLDIGGTKMEAVLLNAAGECVYRQRRPTHKESYDAFMQQLLGLIESVRAWSERPFTL 61 Query: 61 GLGIPGMEDADNGCVLTVNVPAAKGKPLRADLETKLGRAVKVENDANCFALSEAWDDELK 120 G+G+PG D +G + N G LR DL +LG++V + NDA+CF LSEA D Sbjct: 62 GIGLPGAIDPQSGLIKNCNCLVLNGHDLRHDLMRELGQSVWMANDADCFTLSEAVDGAGA 121 Query: 121 EAASVMGLILGTGFGGGLVYEGKVFSGRNHVAGEIGHMRLPIDAWFHLGEKAPLLGCGCG 180 A +V G+I+GTG GGG+ ++ SG N +AGE GH LP + P C CG Sbjct: 122 GATTVFGVIIGTGCGGGVAVNQRLLSGPNAIAGEWGHNPLP---GYRPERDGPAQPCYCG 178 Query: 181 NKGCMDNYLSGRGFELLYEHYYGEKKKAIDIITAQKEGESKAVEHVERFMELLAICFANI 240 + C+++++SG GF YG + ++ II A + G A+ H F++ A A++ Sbjct: 179 KENCIESFISGTGF----ARRYGAQARSEAIIAAAQNGAPLALAHWRHFIDAFARSLASV 234 Query: 241 FTANDPHVVVLGGGLSNYDLIYEEMPKRVPKHLLSVAKCPKIVKAKHGDSGGVRGAAFLN 300 DP V+VLGGGLSN IYE++P + +L S + +I +A+ GD+ GVRGAA+L Sbjct: 235 INILDPQVIVLGGGLSNVGQIYEQLPSAIVPYLFSDSCRTQIKQARFGDASGVRGAAWLP 294 Query: 301 I 301 + Sbjct: 295 V 295 Lambda K H 0.319 0.140 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 304 Length adjustment: 27 Effective length of query: 275 Effective length of database: 277 Effective search space: 76175 Effective search space used: 76175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory