Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate BWI76_RS03130 BWI76_RS03130 putative SN-glycerol-3-phosphate transport system permease
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__Koxy:BWI76_RS03130 Length = 295 Score = 145 bits (365), Expect = 1e-39 Identities = 81/261 (31%), Positives = 139/261 (53%), Gaps = 7/261 (2%) Query: 50 AFMVVLPLLWAVMTSFKDDASIFGSPWS--LPDK-LHFDNWSRAWTEAHMGDYFLNTVLV 106 A + + P LW + TSF A+ FG + LP L DN+ AW A + NT++ Sbjct: 39 ALLWMSPFLWMLATSFS--ATTFGEDMASLLPRMPLTLDNFRDAWDSADWLSLYANTLIF 96 Query: 107 VGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVNNMGLLN 166 G+ L+ + A YV A +F G + ++ +F+ + ++ +VP + GLLN Sbjct: 97 TFGTFFAQLLTITTAGYVFACHEFRGKKTLFLMFLVQLMIMPVVMMVPNMLTLKTFGLLN 156 Query: 167 TLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMAKPGLI 226 TL G+++ Y ++ F VF + F +P + EAA ++G + F+++LPM+ P ++ Sbjct: 157 TLTGVMMPY--FTSAFGVFLMRQAFLAIPKELEEAALMEGCRWWQVLFRVLLPMSWPSVL 214 Query: 227 SVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVMAMLPV 286 + + WN+Y+ P ++ DPDK+VLT GLV A+ G W + AG +M LP+ Sbjct: 215 AFATVSITYHWNEYLWPLMMLNDPDKQVLTVGLVSFAMGAESGGQWGIIGAGTLMVCLPL 274 Query: 287 LAAYIIFQRQVVQGLTAGALK 307 + A+I+FQ+Q ++ +K Sbjct: 275 MLAFILFQKQFLRSFGFSGIK 295 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 295 Length adjustment: 27 Effective length of query: 280 Effective length of database: 268 Effective search space: 75040 Effective search space used: 75040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory