Align Glucose-6-P:Pi antiporter, Hpt (may also transport other organophosphates including C3 organophosphates) (characterized)
to candidate BWI76_RS06050 BWI76_RS06050 MFS transporter family glucose-6-phosphate receptor UhpC
Query= TCDB::Q9Z7N9 (455 letters) >FitnessBrowser__Koxy:BWI76_RS06050 Length = 433 Score = 378 bits (971), Expect = e-109 Identities = 179/420 (42%), Positives = 253/420 (60%), Gaps = 10/420 (2%) Query: 23 VKKKYKYWRIRIFYSMFIGYIFYYFTRKSFTFAMPTLIADLGFDKAQLGIIGSTLYFSYG 82 + Y+ R ++ M IGY +Y TRKS + +P L DLG DK +G++GS Y +YG Sbjct: 9 INHHYRTLRPQLLMYMVIGYAAFYLTRKSVNYVLPALQTDLGLDKGDIGLLGSLFYLTYG 68 Query: 83 ISKFVSGVMSDQSNPRYFMAIGLMITGLTNIFFGMSSSIVLFALWWGLNGWFQGWGWPPC 142 +SKF +G+ D R+FM GL TGL N+ F S+ L W LNG+FQGWGWPPC Sbjct: 69 LSKFAAGLWHDSHGQRWFMGAGLFATGLLNVVFAFGESLTLLLAVWTLNGFFQGWGWPPC 128 Query: 143 ARLLTHWYAKSERGTWWSVWSTSHNIGGALIPILTGFIIDYSGWRGAMYVPGILCIGMGL 202 ARLLTHWY+++ERG WW W+ S NIGGA+IP+++ F + GW+ AM PG++ + G+ Sbjct: 129 ARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLISAFAAHWWGWQAAMLAPGMISMASGI 188 Query: 203 VLINRLRDTPQSLGLPPIEKYKRDPHHAHHEGKSASEGTEEIERELSTREILFTYVLTNQ 262 L +L+ TP+ GLP + ++ DP E +S G ++ R T +L N Sbjct: 189 WLTLQLKGTPREEGLPSVGSWRNDPLELRQERQSPPMGLWQMLR---------TTMLKNP 239 Query: 263 WLWFLAAASFFIYIVRMAVNDWSALFLIETKHYAAVKANFCVSLFEIGGLFGMLVAGWLS 322 +W L + +Y++R+A+NDW ++L E+ + AN V LFE GGL G L AGW S Sbjct: 240 MIWLLGVSYVLVYLIRIALNDWGNIWLTESHGVNLLSANATVMLFEAGGLLGALFAGWGS 299 Query: 323 DKISKGNRGPMNVLFSLGLLFAILGMWFSRSHNQWWVDGTLLFVIGFFLYGPQMMIGLAA 382 D + G R PM +LF+LGL+ ++ +W + H+ + + F +GFF++GPQM+IGLAA Sbjct: 300 DLLFSGQRAPMILLFTLGLMVSVAALWLAPVHH-YALLAVCFFTVGFFVFGPQMLIGLAA 358 Query: 383 AELSHKKAAGTASGFTGWFAYFGATFAGYPLGKVTDVWGWKGFFIALLACASIALLLFLP 442 E HK AAG+ SGF G FAY GA AG+PL V + +GW G F L A + LL +P Sbjct: 359 VECGHKAAAGSISGFLGLFAYLGAALAGWPLSLVIERYGWSGMFSLLSVAAVLMGLLLMP 418 Lambda K H 0.327 0.141 0.476 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 882 Number of extensions: 68 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 433 Length adjustment: 32 Effective length of query: 423 Effective length of database: 401 Effective search space: 169623 Effective search space used: 169623 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory