Align 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 (characterized)
to candidate BWI76_RS19980 BWI76_RS19980 2-keto-3-deoxy-L-rhamnonate aldolase
Query= SwissProt::P23522 (256 letters) >FitnessBrowser__Koxy:BWI76_RS19980 Length = 267 Score = 219 bits (557), Expect = 6e-62 Identities = 112/254 (44%), Positives = 154/254 (60%), Gaps = 1/254 (0%) Query: 3 NDVFPNKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQL 62 N + N FKA L + QIG W + ++ E+ +G+DWL++DGEHAPN I QL Sbjct: 2 NAILSNPFKAGLLQGEAQIGLWLSSTSSYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQL 61 Query: 63 MALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRG 122 A+ S PV+R +IK++LDIG LIP V+T E+A V++TRYPP G RG Sbjct: 62 QAIAPYVSQPVIRPVEGNRSLIKQVLDIGARTLLIPMVDTAEQAREIVSATRYPPVGTRG 121 Query: 123 VSVS-HRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDLA 181 V RA +G V +Y AQ+N + +L+Q+ES+ +DN+DAI EG+DG+F+GP+DL+ Sbjct: 122 VGAGVARAARWGRVENYMAQANDELCLLIQVESKTALDNLDAILEVEGIDGVFIGPADLS 181 Query: 182 AALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLG 241 A+LG+ NA HPDVQ+ I+ R A GK +G LA A + L WGA FVAVG D Sbjct: 182 ASLGYPDNAGHPDVQRIIEQSIRRIRAAGKAAGFLAVDPEMAHKALAWGANFVAVGVDTN 241 Query: 242 VFRSATQKLADTFK 255 ++ A K FK Sbjct: 242 LYTRALDKRLAMFK 255 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 267 Length adjustment: 25 Effective length of query: 231 Effective length of database: 242 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory