Align 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 (characterized)
to candidate BWI76_RS24830 BWI76_RS24830 5-keto-4-deoxy-D-glucarate aldolase
Query= SwissProt::P23522 (256 letters) >FitnessBrowser__Koxy:BWI76_RS24830 Length = 256 Score = 476 bits (1225), Expect = e-139 Identities = 239/256 (93%), Positives = 247/256 (96%) Query: 1 MNNDVFPNKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIP 60 MNND+FPNKFKAALAA QVQIGCWSAL++PISTEVLGLAGFDWLVLDGEHAPNDISTFIP Sbjct: 1 MNNDIFPNKFKAALAAHQVQIGCWSALASPISTEVLGLAGFDWLVLDGEHAPNDISTFIP 60 Query: 61 QLMALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGI 120 QLMALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVET+E+A AVASTRYPPEGI Sbjct: 61 QLMALKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETEEQAVNAVASTRYPPEGI 120 Query: 121 RGVSVSHRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDL 180 RGVSVSHRANMFGTV DYFAQSNKNITILVQIESQQGVDNVDAIAAT GVDGIFVGPSDL Sbjct: 121 RGVSVSHRANMFGTVPDYFAQSNKNITILVQIESQQGVDNVDAIAATPGVDGIFVGPSDL 180 Query: 181 AAALGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDL 240 AAALGHLGNASHP+VQ+AIQHIF A HGKPSGILAPVEADARRYLEWGATFVAVGSDL Sbjct: 181 AAALGHLGNASHPEVQEAIQHIFASAKKHGKPSGILAPVEADARRYLEWGATFVAVGSDL 240 Query: 241 GVFRSATQKLADTFKK 256 GVFRSATQKLAD+FKK Sbjct: 241 GVFRSATQKLADSFKK 256 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 256 Length adjustment: 24 Effective length of query: 232 Effective length of database: 232 Effective search space: 53824 Effective search space used: 53824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate BWI76_RS24830 BWI76_RS24830 (5-keto-4-deoxy-D-glucarate aldolase)
to HMM TIGR03239 (garL: 2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03239.hmm # target sequence database: /tmp/gapView.26260.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03239 [M=249] Accession: TIGR03239 Description: GarL: 2-dehydro-3-deoxyglucarate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-149 481.0 0.1 4.6e-149 480.8 0.1 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS24830 BWI76_RS24830 5-keto-4-deoxy-D-g Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS24830 BWI76_RS24830 5-keto-4-deoxy-D-glucarate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 480.8 0.1 4.6e-149 4.6e-149 1 249 [] 8 256 .] 8 256 .] 1.00 Alignments for each domain: == domain 1 score: 480.8 bits; conditional E-value: 4.6e-149 TIGR03239 1 nrfrqkllarktliglwsalgnpitaevlglagfdwllldgehapndvltlipqlmalkdsasapvvrvpl 71 n+f+++l+a++++ig+wsal++pi++evlglagfdwl+ldgehapnd++t+ipqlmalk+sasapvvrvp+ lcl|FitnessBrowser__Koxy:BWI76_RS24830 8 NKFKAALAAHQVQIGCWSALASPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALKGSASAPVVRVPT 78 8********************************************************************** PP TIGR03239 72 nepviikrlldigfynllipfvesaeeaeravaatryppegirgvsvaqrsnrygtvadyfkkindnitvl 142 nepviikrlldigfyn+lipfve++e+a +ava+tryppegirgvsv++r+n++gtv+dyf+++n+nit+l lcl|FitnessBrowser__Koxy:BWI76_RS24830 79 NEPVIIKRLLDIGFYNFLIPFVETEEQAVNAVASTRYPPEGIRGVSVSHRANMFGTVPDYFAQSNKNITIL 149 *********************************************************************** PP TIGR03239 143 vqiesrkgvdavdeiaavdgvdgvfvgpsdlaaalgylgnpnhpdvqkairhifdraaahgkavgilapve 213 vqies++gvd+vd+iaa++gvdg+fvgpsdlaaalg+lgn++hp+vq+ai+hif++a++hgk++gilapve lcl|FitnessBrowser__Koxy:BWI76_RS24830 150 VQIESQQGVDNVDAIAATPGVDGIFVGPSDLAAALGHLGNASHPEVQEAIQHIFASAKKHGKPSGILAPVE 220 *********************************************************************** PP TIGR03239 214 adarrylelgatfvavgsdlgvfrsatkalsekfkk 249 adarryle+gatfvavgsdlgvfrsat++l++ fkk lcl|FitnessBrowser__Koxy:BWI76_RS24830 221 ADARRYLEWGATFVAVGSDLGVFRSATQKLADSFKK 256 **********************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (249 nodes) Target sequences: 1 (256 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.94 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory