Align Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE; KDG aldolase YagE; Putative 2-dehydro-3-deoxy-D-pentonate aldolase YagE; EC 4.1.2.51; EC 4.1.2.28 (characterized)
to candidate BWI76_RS26315 BWI76_RS26315 dihydrodipicolinate synthase family protein
Query= SwissProt::P75682 (302 letters) >FitnessBrowser__Koxy:BWI76_RS26315 Length = 299 Score = 164 bits (415), Expect = 2e-45 Identities = 87/288 (30%), Positives = 149/288 (51%), Gaps = 1/288 (0%) Query: 11 IPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARFAID 70 I P T+F G+LD G L D IK V G +GS GEF L + + I + A + Sbjct: 6 ITPAITVFDEQGRLDPDGNFRLYD-FIKNSVSGFVVMGSTGEFFSLDMKTSRQIIQMAAE 64 Query: 71 HVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQVADS 130 + + G + E +EL+ +A + G DG+++I+P+Y+++++ + ++ Q+A Sbjct: 65 FPRQGIKAYAGASRMDIDECVELANYADECGLDGVMIISPWYFRLTDEGIYTFYSQIARR 124 Query: 131 VTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMIHTVKGAHPHF 190 + +YNFP TG ++P + LA NIIG+KDTI H +I VK P+F Sbjct: 125 TAAKIFIYNFPERTGYSVSPEVCLRLAREFPNIIGLKDTIPDTNHTSQVIRQVKSELPYF 184 Query: 191 TVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLLQIPQ 250 V GYD++ + +L GG+G I N P++ + ++A+ D D+ + Y Q + + Sbjct: 185 EVYAGYDNNFAHNVLSGGNGCIGGLSNICPELFRDWMQAFSDNDLPQIRRYQQKVDGLMD 244 Query: 251 MYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQ 298 +Y ++ PF+ K+A+ L G S PP S L + ++ +L + Sbjct: 245 IYAVNDPFIPTFKKALQLRGIIQSDRCTPPFSSLATCQTESIQRILSR 292 Lambda K H 0.320 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 299 Length adjustment: 27 Effective length of query: 275 Effective length of database: 272 Effective search space: 74800 Effective search space used: 74800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory