Align Gluconolactonase; EC 3.1.1.-; EC 3.1.1.17 (characterized, see rationale)
to candidate BWI76_RS23720 BWI76_RS23720 calcium-binding protein
Query= uniprot:Q88NN7 (293 letters) >FitnessBrowser__Koxy:BWI76_RS23720 Length = 292 Score = 168 bits (425), Expect = 2e-46 Identities = 107/302 (35%), Positives = 164/302 (54%), Gaps = 19/302 (6%) Query: 1 MNCELIVDARNGTGESPVWHPGEQALYWVDIPARQLHRWQAADGKHQCWQGDEMLACIA- 59 M E+++D + GESPVW +Q L+WVD +L A G + W + + A Sbjct: 1 MRIEVLLDLKTRLGESPVWDIEQQRLWWVDSLDGRLFACNAQGGAIKSWDVRQKIGSFAL 60 Query: 60 -RSGQGWVAGMESGIFQLQAKADGSLDSRLLSNVQHAQAGM---RFNDGRCDRQGRFWAG 115 ++G+G V +++G+ L + G L+ + H +A R NDG+ DRQGRF G Sbjct: 61 RQNGEGAVVALQNGVHLLDFASGG------LTLLHHPEADRPFNRLNDGKVDRQGRFLFG 114 Query: 116 TMLLDMQQGAHVGALYRHDGEGHLHLQQDGMIVPNGLAFSPDGKRMYLSDSHPNVQKVWA 175 +M DM++ GALYR D + LH+ + +IV N +SP G+ Y +D+ ++ A Sbjct: 115 SM--DMREEEPSGALYRLDADLSLHVLKKNIIVSNAPCWSPSGETFYFADTWTG--EICA 170 Query: 176 FDYDTDSGTPHGKHLFVDM-RNYPGRPDGAAIDQDGCYWICGNDAGQIHRFTPEGRLDRS 234 +DY+T +G G+ +F + R+ G DGA +D +G W AG++ R+TPEG +DR Sbjct: 171 WDYNTATGDLSGERVFCHVDRSEGGAADGATVDSEGYLWNALVYAGKLVRYTPEGEVDRI 230 Query: 235 LSVPVKKPAMCAFGGASLDILYVTSIR--PTGIDLSDQPLAGGVFAL-DPGTKGLEEPAY 291 + +PVKK FGG +LD+LYVTS+ P D L G +FA+ D G G+ E + Sbjct: 231 IEMPVKKVTSVMFGGENLDVLYVTSMAQPPLPRFPEDNQLRGSLFAIYDLGVTGVAERRF 290 Query: 292 RG 293 G Sbjct: 291 AG 292 Lambda K H 0.320 0.139 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 292 Length adjustment: 26 Effective length of query: 267 Effective length of database: 266 Effective search space: 71022 Effective search space used: 71022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory