Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate BWI76_RS05990 BWI76_RS05990 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >FitnessBrowser__Koxy:BWI76_RS05990 Length = 299 Score = 208 bits (529), Expect = 1e-58 Identities = 118/300 (39%), Positives = 177/300 (59%), Gaps = 13/300 (4%) Query: 4 FVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFAG 63 F+QQ++NG++LG +Y L+AIGYTMVYG++ +INFAH D+ M+G F L +F + G Sbjct: 6 FLQQVVNGMSLGGMYALIAIGYTMVYGVLRLINFAHADVMMVGAFTTLFLFSSI-----G 60 Query: 64 LPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQVTQ 123 LP V + + L + L+ I+RVAYRPLR + +++ LITAIG+S L N V Sbjct: 61 LPFGVAVFLTLALC----GLFGMLIDRVAYRPLRQASKISMLITAIGVSFFLENLFNVLF 116 Query: 124 GPRNK--PIPPMVSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRATEQ 181 G ++ P ++ FG++ ++ I+ +IT +LL +++ RT G A RA Sbjct: 117 GGSSRFFSAPDFFNNTRAFGDVIITNVAWIVPLITVLLLLAILWLLYRTRYGMAIRAVAF 176 Query: 182 DRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTAAVLG 241 D L+G++ ++ IS+ F +G++LAA+ G Y + Y G G+KAF AAVLG Sbjct: 177 DVNTVRLMGIDANRIISLVFALGSSLAALGGVFYSISYPTIDPLMGVLIGLKAFAAAVLG 236 Query: 242 GIGSLPGAVFGGLLIGLIESLWSAYFTI--AYKDVATFAILAFVLIFKPTGILGRPEVEK 299 GIGS+ GAV GG ++G E + A F YKD F L VL+F+P GI+G +E+ Sbjct: 237 GIGSVTGAVLGGFILGFTEVVAVALFPELGGYKDAFAFMFLILVLLFRPVGIMGDERLER 296 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 299 Length adjustment: 27 Effective length of query: 273 Effective length of database: 272 Effective search space: 74256 Effective search space used: 74256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory