Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate BWI76_RS05985 BWI76_RS05985 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__Koxy:BWI76_RS05985 Length = 349 Score = 156 bits (394), Expect = 1e-42 Identities = 114/322 (35%), Positives = 163/322 (50%), Gaps = 50/322 (15%) Query: 142 ILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVGAYSYALL--SSYFGLSF--------WVL 191 I ++++LA N++ G+ G L L F AVGAY ALL SS L W+L Sbjct: 43 IFVFMILAVSYNLINGVTGQLSLEPNGFVAVGAYVTALLILSSDSKLDMFEMAAPSPWIL 102 Query: 192 ---------LPLSGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLINWTDVTKG 242 L +SG+ AA V L PV R+RGDYLAIVTL FG II+++ IN +T G Sbjct: 103 VLHAGFLPALLISGLCAAALAVCLALPVFRVRGDYLAIVTLGFGFIIKILAINNPQITNG 162 Query: 243 TFGISSIPKATLFGIPFDATAGGFAKLFHLPISSAYYKIFLFYLILALCMLTAYVTIRLR 302 G++ IP+ HL LF+ L + T + ++L Sbjct: 163 AIGLNDIPQQP-----------------HL----------LFWCGLFALLATGMI-LQLV 194 Query: 303 RMPIGRAWEALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFV 362 GR +A+R+DE A ++G+NT K AFAT A F G G A+ +SP F Sbjct: 195 WSKYGRMMKAVRDDEDAAIAMGVNTFRIKTCAFATSAFFEGIGGGLLASLLTTISPGLFD 254 Query: 363 FLESAVILAIVVLGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGPDF--TPELYRML 420 F+ + +L I+VLGG+GS TG + +++VG E LR + FG D P L RM+ Sbjct: 255 FMLTFQLLIIIVLGGLGSTTGALLGTVLVVGSGEWLRFLDQPLQFFGHDLGAYPGL-RMV 313 Query: 421 IFGLAMVVVMLFKPRGFVGSRE 442 +F L ++++MLF G +G +E Sbjct: 314 VFSLLLLIIMLFAREGLLGKKE 335 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 349 Length adjustment: 31 Effective length of query: 432 Effective length of database: 318 Effective search space: 137376 Effective search space used: 137376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory