GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fumD in Klebsiella michiganensis M5al

Align fumarate hydratase (EC 4.2.1.2); (S)-2-methylmalate dehydratase (EC 4.2.1.34) (characterized)
to candidate BWI76_RS16275 BWI76_RS16275 fumarate hydratase FumA

Query= BRENDA::P0AC33
         (548 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS16275 BWI76_RS16275 fumarate
           hydratase FumA
          Length = 548

 Score = 1001 bits (2588), Expect = 0.0
 Identities = 488/548 (89%), Positives = 520/548 (94%)

Query: 1   MSNKPFHYQAPFPLKKDDTEYYLLTSEHVSVSEFEGQEILKVAPEALTLLARQAFHDASF 60
           MSNKPF YQ PFPLKKDDTEYYLL+S++VSV+EF GQE+LKV P+ALTLLA+ AFHDASF
Sbjct: 1   MSNKPFVYQDPFPLKKDDTEYYLLSSDYVSVAEFAGQEVLKVEPQALTLLAQHAFHDASF 60

Query: 61  MLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIIVGKKGQR 120
           MLRPAHQQQVADIL DPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAII GKKGQR
Sbjct: 61  MLRPAHQQQVADILNDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIITGKKGQR 120

Query: 121 VWTGGGDEAALARGVYNTYIEDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYAVDGDEYKF 180
           VWTGGGDEAALA+GVYNTYI+DNLRYSQNAPLDMYKEVNTGTNLPAQIDLYA DG+EYKF
Sbjct: 121 VWTGGGDEAALAQGVYNTYIQDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYATDGEEYKF 180

Query: 181 LCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAET 240
           LCIAKGGGSANKTYLYQETKAL+TP KLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAE+
Sbjct: 181 LCIAKGGGSANKTYLYQETKALITPAKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAES 240

Query: 241 NLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQNLGLGAQFGGKYFAHDIRV 300
            LKTVKLAS KYYD LPTEGNEHGQAFRD++LE+ELL EAQNLGLGAQFGGKYFAHDIRV
Sbjct: 241 TLKTVKLASTKYYDGLPTEGNEHGQAFRDIQLEQELLAEAQNLGLGAQFGGKYFAHDIRV 300

Query: 301 IRLPRHGASCPVGMGVSCSADRNIKAKINRQGIWIEKLEHNPGKYIPEELRKAGEGEAVR 360
           IRLPRHGASCPVGMGVSCSADRNIKAKINR+GIW+EKLE NPGKYIPE LR+AGEGEAV+
Sbjct: 301 IRLPRHGASCPVGMGVSCSADRNIKAKINREGIWLEKLESNPGKYIPEHLRQAGEGEAVK 360

Query: 361 VDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIY 420
           V+LN+PM +ILA LSQYPVSTRLSL+GTIIV RDIAHAKLKE +D+GE LPQY+KDHPIY
Sbjct: 361 VNLNQPMSDILALLSQYPVSTRLSLSGTIIVARDIAHAKLKELIDSGEELPQYVKDHPIY 420

Query: 421 YAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQAQGGSMIMLAKGNRSQQVTDACKKHGGF 480
           YAGPAKTP+GYASGSLGPTTAGRMDSYVD LQ+ G SM+MLAKGNRSQQVTDAC KHGGF
Sbjct: 421 YAGPAKTPDGYASGSLGPTTAGRMDSYVDLLQSHGASMVMLAKGNRSQQVTDACHKHGGF 480

Query: 481 YLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIQL 540
           YLGSIGGPAAVLAQ SI+SLECV YPELGMEAIWKIEVE+FPAFILVDDKGNDFFQQIQ 
Sbjct: 481 YLGSIGGPAAVLAQQSIRSLECVAYPELGMEAIWKIEVENFPAFILVDDKGNDFFQQIQS 540

Query: 541 TQCTRCVK 548
           +QC RCVK
Sbjct: 541 SQCARCVK 548


Lambda     K      H
   0.317    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1171
Number of extensions: 32
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 548
Length of database: 548
Length adjustment: 36
Effective length of query: 512
Effective length of database: 512
Effective search space:   262144
Effective search space used:   262144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory