Align Tonoplast intrinsic protein-a (transports water, urea, glycerol and gases (CO2 and NH3) (characterized)
to candidate BWI76_RS09585 BWI76_RS09585 aquaporin
Query= TCDB::Q9XG70 (247 letters) >FitnessBrowser__Koxy:BWI76_RS09585 Length = 231 Score = 98.6 bits (244), Expect = 1e-25 Identities = 76/225 (33%), Positives = 104/225 (46%), Gaps = 24/225 (10%) Query: 21 LIVEFICTFLFVFAGVGSAMAANKLNGDPLVSLFF--VAMAHALVVAVTISAGFRISGGH 78 L E TF VF G GSA+ A P + + F VA+A L V A ISGGH Sbjct: 5 LAAECFGTFWLVFGGCGSAVLAAAF---PELGIGFAGVALAFGLTVLTMAYAVGHISGGH 61 Query: 79 LNPAVTLGLCMGGHITVFRSILYWIDQLLASVAACALLNYLTAGLETPVHTLANGVS--- 135 NPAVTLGL GG I Y I Q++ + A A+L Y+ A + A+G + Sbjct: 62 FNPAVTLGLWAGGRFPAKEVIGYIIAQVVGGIIAAAIL-YVVASGKAGFDAAASGFASNG 120 Query: 136 YGQ----------GIIMEVILTFSLLFTVYTTIVDPKKGILEGMGPLLTGLVVGANIMAG 185 YG+ I++E++LT L ++ K G P+ GL + + Sbjct: 121 YGEHSPGGFSMLSAIVIEIVLTCGFLLVIHGA---TDKNAPAGFAPIAIGLALTLIHLIS 177 Query: 186 GPFSGASMNPARSFGPAFVSGIWT--DHWVYWVGPLIGGGLAGFI 228 P + S+NPARS A G W W++WV P+IGG L G + Sbjct: 178 IPVTNTSVNPARSTAVAIFQGGWALQQLWLFWVMPIIGGILGGVL 222 Lambda K H 0.327 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 231 Length adjustment: 23 Effective length of query: 224 Effective length of database: 208 Effective search space: 46592 Effective search space used: 46592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory