Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate BWI76_RS06035 BWI76_RS06035 ferric transporter ATP-binding subunit
Query= TCDB::G3LHY9 (356 letters) >FitnessBrowser__Koxy:BWI76_RS06035 Length = 348 Score = 192 bits (488), Expect = 1e-53 Identities = 110/293 (37%), Positives = 167/293 (56%), Gaps = 8/293 (2%) Query: 35 GGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNLSTQSRNIAQVFQFPVIYD 94 G LLGPSGCGKTT+L +++GL +PS G+I DG+DVT+ S Q R+I VFQ ++ Sbjct: 32 GQMVTLLGPSGCGKTTILRLVAGLEKPSEGQIYIDGEDVTHRSIQQRDICMVFQSYALFP 91 Query: 95 TMTVYDNLAFPLRNRGVAEADVDRRVRDILEMIDLASWARRKAQGLTADQKQKISLGRGL 154 M++ DN+ + L+ GV DV RV++ L M+DL + R ++ Q+Q+++L R L Sbjct: 92 HMSLGDNVGYGLKMLGVPRGDVKARVKEALAMVDLEGFEDRYVDQISGGQQQRVALARAL 151 Query: 155 VRNDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHDQTEALTFAEKVVVM 214 + +LFDEPL+ +D +++ +R +++ L KQF T +YVTHDQ+EA ++ V+VM Sbjct: 152 ILKP-KVLLFDEPLSNLDANLRRSMRDKIRELQKQFDITSLYVTHDQSEAFAVSDTVLVM 210 Query: 215 YDGQIVQIGTPAELFERPSHTFVGYFIGSPGMNFMPARIEGSTVKVGDETLTLEYAPKTS 274 G I+QIG+P EL+ +P+ F+ F+G N PA V + L P + Sbjct: 211 NKGHIMQIGSPQELYRQPASRFMASFMGD--ANLFPAAFSEDFVDI--YGYRLPRPPHFA 266 Query: 275 GTAKTELGIRPEFIRL---GREGMPITISKVEDIGRQKIVRARFADQPIAIVV 324 + +G+RPE I L G E TI V +G Q V + Q I + V Sbjct: 267 AHGEGSVGVRPEAITLSDRGEESQRCTIRHVAYMGPQYEVTVEWHGQEILLQV 319 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 348 Length adjustment: 29 Effective length of query: 327 Effective length of database: 319 Effective search space: 104313 Effective search space used: 104313 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory