Align ABC transporter for L-Histidine, periplasmic substrate-binding component 2 (characterized)
to candidate BWI76_RS22885 BWI76_RS22885 aliphatic sulfonate ABC transporter substrate-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2562 (321 letters) >FitnessBrowser__Koxy:BWI76_RS22885 Length = 313 Score = 56.6 bits (135), Expect = 8e-13 Identities = 49/150 (32%), Positives = 67/150 (44%), Gaps = 4/150 (2%) Query: 54 FKKNGLDVEIKMIPQKDRHL-ALASKSIQCAATTVETHVAWNANGVPIVQIFQMDKSYGA 112 FKK G+ V P + L L SI AAT A +V + + Sbjct: 51 FKKQGIAVRWIEFPAGPQMLEGLNVGSIDLAATGDAPPAFAQAAQADLVYLAHSPANPKT 110 Query: 113 DGIAVRGD--IKSFADLKGKTIGVDAPGTAPYFGLAWMLSKNGMSLKDVKTTTLSPQAAA 170 + I V + IKS ADLKGK +G++ Y L L K G+S KD+ L P A Sbjct: 111 EAIVVAENSAIKSVADLKGKRVGLNKGSDVNYL-LVTALEKAGLSYKDITPVYLPPADAR 169 Query: 171 QAFVAGQNDAAMTYEPYLSTVRDNPAAGKI 200 AF G DA + ++P+L+ V N A +I Sbjct: 170 AAFQRGAIDAWVIWDPFLAEVETNAKARQI 199 Lambda K H 0.317 0.129 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 313 Length adjustment: 27 Effective length of query: 294 Effective length of database: 286 Effective search space: 84084 Effective search space used: 84084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory