Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate BWI76_RS19235 BWI76_RS19235 polar amino acid ABC transporter inner membrane subunit
Query= uniprot:B2TBJ7 (240 letters) >FitnessBrowser__Koxy:BWI76_RS19235 Length = 230 Score = 145 bits (367), Expect = 5e-40 Identities = 77/208 (37%), Positives = 129/208 (62%), Gaps = 1/208 (0%) Query: 17 VLLLAALMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGDIYTTVFRGVPELLVIYL 76 +LL A +++ + L++L V + G + + KL LR+ YTT+ RG+PEL+++ L Sbjct: 8 LLLRGAALSLCVMLSSLLVALLLGLINSLIKLFGPPWLRLFSTAYTTLVRGIPELVIMLL 67 Query: 77 FYFGGSTLVTSVGQLFGAEGFVGVPPFVVGALAVGMISGAYQAEVYRSAVLAVSRGELEA 136 +FGG LV + L G G V F+ G LA+G + GAY E +R A L V G+ EA Sbjct: 68 LFFGGEMLVNLLLGLVGL-GPVRFNTFISGVLAIGFVFGAYYTETFRGAFLTVDSGQTEA 126 Query: 137 ARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDSALISVTGLAELLRTSQVAAGS 196 A++ GM T+ RR+++PQ+L FA+PGI N W +K SAL+S+ GL +++ ++ A + Sbjct: 127 AQAYGMRPWTVFRRVMLPQMLSFAIPGINNNWLGLMKASALVSILGLEDMVWLAEQAGRA 186 Query: 197 THQYFTFFVVGGALYLIMTSISNRVFNR 224 T + F F+ + +Y+++T++S+ +F+R Sbjct: 187 TQKPFLFYFLVSLIYMVITALSSWLFSR 214 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 230 Length adjustment: 23 Effective length of query: 217 Effective length of database: 207 Effective search space: 44919 Effective search space used: 44919 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory