Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate BWI76_RS16675 BWI76_RS16675 ABC transporter
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__Koxy:BWI76_RS16675 Length = 348 Score = 265 bits (677), Expect = 1e-75 Identities = 154/311 (49%), Positives = 195/311 (62%), Gaps = 6/311 (1%) Query: 2 IEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGR 61 I+ + K Y + AL+ L I G+IFG+IG SGAGKSTLLRL NRLE G Sbjct: 11 IQLSQISKAYP---NGVQALRDINLQIAQGEIFGIIGRSGAGKSTLLRLFNRLENADSGE 67 Query: 62 ILVEGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDAR 121 I + GE LR R+RV MIFQHFNL+++KTVA N+ +PL++AG RAE R Sbjct: 68 ITIHGEHTRHYSRSQLRDLRRRVAMIFQHFNLMATKTVAQNVELPLKMAG-VPRAERQKR 126 Query: 122 VSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVL 181 V E+LA VGLS +PA+LSGGQKQR GIARAL +P ILLCDEATSALDP+ T +VL Sbjct: 127 VDEILALVGLSALRDSWPAKLSGGQKQRTGIARALVTQPEILLCDEATSALDPENTHAVL 186 Query: 182 QLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRF 241 +LL EIN+ L LTIVLITHEMDVIR +CD+VAV++ G I+EQG+V VF HP H TR Sbjct: 187 KLLKEINQRLGLTIVLITHEMDVIRTLCDRVAVLEHGEIIEQGEVWRVFGHPGHAVTRSL 246 Query: 242 VFEAERVDEDERHDDFAHVPGLILRLTFRGEATYAPLLGTVARQTGVDYSILSGRIDRIK 301 + +ER + ++ L F G + P L +A G D +L G ++I+ Sbjct: 247 LGTLHHDRAEERLSLSENQQ--LVTLHFDGSSGQEPDLQRIAALLGADARLLYGSCEQIQ 304 Query: 302 DTPYGQLTLAL 312 GQL + L Sbjct: 305 GRVIGQLRIRL 315 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 348 Length adjustment: 29 Effective length of query: 306 Effective length of database: 319 Effective search space: 97614 Effective search space used: 97614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory