Align D-methionine ABC transporter membrane protein, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate BWI76_RS05360 BWI76_RS05360 methionine ABC transporter permease
Query= TCDB::Q9HT69 (225 letters) >FitnessBrowser__Koxy:BWI76_RS05360 Length = 217 Score = 198 bits (503), Expect = 8e-56 Identities = 104/197 (52%), Positives = 137/197 (69%) Query: 23 DTFWMLGGSLLFTVVLGLPLGVLLFLTGPRQMFEQKAVYTLLSLVVNILRSLPFIILLIV 82 +T M S F VLGLP+GVLL++T P Q+ +Y LS VVNI RS+PFIILL+ Sbjct: 15 ETLAMTFVSGFFGFVLGLPVGVLLYVTRPGQIAANAKLYRTLSAVVNIFRSIPFIILLVW 74 Query: 83 MIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETALREVDKGIIEATQAMGASTRQII 142 MIP T +I GTS+G+ AI PL VGA PF AR+VE AL E+ G+IEA++AMGA+ QI+ Sbjct: 75 MIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIV 134 Query: 143 WNALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVV 202 LLPEA PG++ A T+T ITLV Y+AM G VGAGGLG + ++GY + VM +V Sbjct: 135 RKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNATVMNTVLV 194 Query: 203 MLLILVQILQTVGDKLV 219 +L+ILV ++Q GD++V Sbjct: 195 LLVILVYLIQFSGDRIV 211 Lambda K H 0.329 0.143 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 217 Length adjustment: 22 Effective length of query: 203 Effective length of database: 195 Effective search space: 39585 Effective search space used: 39585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory