Align D-methionine ABC transporter membrane protein, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate BWI76_RS15035 BWI76_RS15035 metal ABC transporter permease
Query= TCDB::Q9HT69 (225 letters) >FitnessBrowser__Koxy:BWI76_RS15035 Length = 223 Score = 207 bits (528), Expect = 1e-58 Identities = 106/214 (49%), Positives = 151/214 (70%), Gaps = 4/214 (1%) Query: 10 ANIDWYEIW----LASVDTFWMLGGSLLFTVVLGLPLGVLLFLTGPRQMFEQKAVYTLLS 65 +++ W ++W +VDT +++G + LFTV+LGLP GVLLF++ + + +L Sbjct: 3 SSMSWEDLWPLLLQGTVDTVYIVGLAALFTVLLGLPTGVLLFVSRRNGLAPMPKLNAVLG 62 Query: 66 LVVNILRSLPFIILLIVMIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETALREVDK 125 ++N RSLPFI+LLI +IP T LI GT+LG A+ P+ +GA PFFARL E AL EVD Sbjct: 63 AIINFGRSLPFIVLLIALIPFTRLIIGTTLGSTAAVVPVTIGAFPFFARLTENALDEVDY 122 Query: 126 GIIEATQAMGASTRQIIWNALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGLGDLAI 185 G IEA +MG + +I+ +LLPEA P ++A IT+T + L+ +++MAGV+G GGLGDLAI Sbjct: 123 GRIEAILSMGGNIWHVIFKSLLPEALPTLLAGITLTIVMLIGFSSMAGVIGGGGLGDLAI 182 Query: 186 RFGYQRFQTDVMVVTVVMLLILVQILQTVGDKLV 219 R+GYQRF +VMV TV++L+ LVQ +Q GD+LV Sbjct: 183 RYGYQRFNNEVMVGTVLILVALVQGVQMAGDRLV 216 Lambda K H 0.329 0.143 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 223 Length adjustment: 22 Effective length of query: 203 Effective length of database: 201 Effective search space: 40803 Effective search space used: 40803 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory