Align Probable TonB-dependent receptor, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate BWI76_RS16320 BWI76_RS16320 methionine ABC transporter substrate-binding protein
Query= TCDB::Q9HT68 (260 letters) >FitnessBrowser__Koxy:BWI76_RS16320 Length = 270 Score = 182 bits (463), Expect = 5e-51 Identities = 103/263 (39%), Positives = 153/263 (58%), Gaps = 6/263 (2%) Query: 1 MKKLLAAFSAVAALGLTAAQAAES---LTVAATPVPHAEILNVVKPLLA-KEGVDLKIKE 56 +KK+ ++L L A + E + V + E+ V + + K +D+++ Sbjct: 5 LKKIAVPLIVASSLLLAACKPGEDPNHIKVGISAGVDQEVWAVAQKVAKEKYNLDVEVVT 64 Query: 57 FTDYVQPNVQVSEKRLDANFFQHQPYLDEFNKAKGTDLVAVTGVHIEPLGAYSSKYKKLD 116 F D+V PN ++ LDAN FQH+PYLD+ + +G LV V + P+ AYS K + Sbjct: 65 FNDFVLPNEALNNGDLDANAFQHRPYLDKQIQERGYKLVQVGTTFVYPIAAYSKKITSVA 124 Query: 117 ELPSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKSITATPKDIVDNPKNIKIRELEAA 176 +LP GA V +PND TN GR+LLLL K G+I LKD + T DI++NPK +KI E+EA Sbjct: 125 QLPDGAQVAVPNDPTNLGRSLLLLQKQGLITLKDGVGLLPTSLDIINNPKKLKIVEIEAP 184 Query: 177 TLPRVL--TQVDMALINTNYALEAKLNPTKDALAIEGSDSPYVNILVARPDNKDSDAMQK 234 L R L Q+ MA+INT ++ + L+P+++ L +E DSPYVNI +R +NKDS+ ++ Sbjct: 185 QLTRALDDQQITMAIINTTFSSQVGLSPSRNGLFVESKDSPYVNIFASRIENKDSEKVKN 244 Query: 235 LAKALHSAEIKQFIQEKYKGAVV 257 L KA S E+ + YKG V Sbjct: 245 LVKAYQSDEVAAAAERLYKGDAV 267 Lambda K H 0.314 0.131 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 270 Length adjustment: 25 Effective length of query: 235 Effective length of database: 245 Effective search space: 57575 Effective search space used: 57575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory