Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (characterized)
to candidate BWI76_RS08100 BWI76_RS08100 glutamate/aspartate transporter permease GltK
Query= reanno::Smeli:SMc02119 (397 letters) >FitnessBrowser__Koxy:BWI76_RS08100 Length = 224 Score = 89.7 bits (221), Expect = 7e-23 Identities = 66/216 (30%), Positives = 109/216 (50%), Gaps = 12/216 (5%) Query: 181 PIAEEGAEYTLLAFVIAVAASVFFARYARKRQLATGERLPVLW---TVLGLIIGLPLVTF 237 P G TL V A+ + + +L++ LP+ W T + + +PLV Sbjct: 14 PYLLAGLVITLKITVTAIVIGIVWGTILAVMRLSSF--LPLAWFAKTYVNVFRSIPLVMV 71 Query: 238 LVTGAPITFDIPVAGKF-NLTGGSV-VGPEFMSLFLALSFYTAAFIAEIVRAGIRGVSKG 295 L + F + V G N+ G S +S +A S + AA+ +EI+RAGI+ +S+G Sbjct: 72 L-----LWFYLIVPGFLQNVLGLSPKTDIRLISAMIAFSMFEAAYYSEIIRAGIQSISRG 126 Query: 296 QTEAAHALGIRPALTTRLVVVPQAMRIIIPPLTSQYLNLTKNSSLAVAIGYADLVAVGGT 355 Q+ AA ALG+ + +LV++PQA R ++P L +Q + L +++SL + AD T Sbjct: 127 QSSAALALGMTHWQSMKLVILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTAST 186 Query: 356 ILNQTGQSIEIVSIWLIVYLSLSLATSLFMNWYNAR 391 I + G +E++ VY SL+ SL ++W R Sbjct: 187 IGERDGTQVEMILFAGAVYFVFSLSASLLVSWLKKR 222 Score = 45.8 bits (107), Expect = 1e-09 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%) Query: 89 LLVGFINTLLVAITGIITATIIGFIVGIGRLSHNWIIAKLSLAYVEVFRNIPPLLVIFFW 148 LL G + TL + +T I+ + G I+ + RLS +A + YV VFR+IP ++V+ ++ Sbjct: 16 LLAGLVITLKITVTAIVIGIVWGTILAVMRLSSFLPLAWFAKTYVNVFRSIPLVMVLLWF 75 Query: 149 YSGVLSILPQARDALALPFDIFLSNRGVAF 178 Y V L L+ DI L + +AF Sbjct: 76 YLIVPGFLQNVL-GLSPKTDIRLISAMIAF 104 Lambda K H 0.327 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 397 Length of database: 224 Length adjustment: 26 Effective length of query: 371 Effective length of database: 198 Effective search space: 73458 Effective search space used: 73458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory