Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate BWI76_RS10585 BWI76_RS10585 amino acid ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Koxy:BWI76_RS10585 Length = 246 Score = 251 bits (642), Expect = 7e-72 Identities = 129/244 (52%), Positives = 175/244 (71%), Gaps = 3/244 (1%) Query: 7 PLISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLE 66 PLI+ +Q+QK +G VL+GV +I +VISIIG SG GKST LRC+N LE G ++ Sbjct: 2 PLITINQMQKYYGDNHVLKGVDLDIDMGEVISIIGRSGSGKSTLLRCINGLEGYQEGSIK 61 Query: 67 VAGVDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKDR 126 + G+ ++ R++ +GMVFQ+FNLFPH+T L+N++LAPR+VL+ AE ++ Sbjct: 62 LGGMTITDR---DSQAREISRSIGMVFQNFNLFPHMTALENVMLAPRRVLKKSAAECREL 118 Query: 127 ALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEVL 186 A L+KVGLG + D YP LSGGQ+QRVAIAR L M P++LL DE TSALDPELVGEVL Sbjct: 119 AQRMLEKVGLGDRLDYYPSSLSGGQQQRVAIARALAMSPKVLLCDEITSALDPELVGEVL 178 Query: 187 NVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRAFL 246 V++QLA EGMT+ +VTHEM FAREV +RV F +QG + E+GD +F NP++ L+ F+ Sbjct: 179 KVLEQLAAEGMTLILVTHEMNFAREVGDRVVFMHQGRVWEQGDSKTLFANPQTSELKQFI 238 Query: 247 SRIQ 250 S ++ Sbjct: 239 SSVR 242 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 246 Length adjustment: 24 Effective length of query: 228 Effective length of database: 222 Effective search space: 50616 Effective search space used: 50616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory