Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate BWI76_RS20320 BWI76_RS20320 histidine/lysine/arginine/ornithine ABC transporter ATP-binding protein HisP
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Koxy:BWI76_RS20320 Length = 257 Score = 255 bits (652), Expect = 5e-73 Identities = 139/242 (57%), Positives = 173/242 (71%), Gaps = 9/242 (3%) Query: 14 LQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLEVAGVDLS 73 L K +G +VL+GV+ DVISIIG SG GKSTFLRC+N LE S G + V G ++ Sbjct: 11 LHKRYGEHEVLKGVSLRAKAGDVISIIGSSGSGKSTFLRCINFLEKPSEGTIVVNGQNIG 70 Query: 74 GAK--------IDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKD 125 + D+ LR LR R+ MVFQHFNL+ H+TVL+N++ AP +VL + EA+D Sbjct: 71 LVRDKDGQLKVSDKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEARD 130 Query: 126 RALTYLDKVGLGTKAD-NYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGE 184 RA+ YL KVG+ + YP LSGGQ+QRV+IAR L M+P++LLFDEPTSALDPELVGE Sbjct: 131 RAVKYLAKVGIDERQQIKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGE 190 Query: 185 VLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRA 244 VL +M+QLAEEG TM VVTHEM FAR VS+ V F +QG IEEEG P++VF NPKS RL+ Sbjct: 191 VLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGHPDDVFGNPKSQRLQQ 250 Query: 245 FL 246 FL Sbjct: 251 FL 252 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 257 Length adjustment: 24 Effective length of query: 228 Effective length of database: 233 Effective search space: 53124 Effective search space used: 53124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory