Align Histidine transport system permease protein HisM (characterized)
to candidate BWI76_RS10375 BWI76_RS10375 polar amino acid ABC transporter inner membrane subunit
Query= SwissProt::P0AEU3 (238 letters) >FitnessBrowser__Koxy:BWI76_RS10375 Length = 221 Score = 115 bits (288), Expect = 7e-31 Identities = 74/229 (32%), Positives = 118/229 (51%), Gaps = 11/229 (4%) Query: 5 LHEYWK-PLLWTD-GYRFTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIWLF 62 +H W L+W + G+ +TL L +L+ ++G +L L + + R ++ F Sbjct: 1 MHYQWDFSLVWQNLPVLLKGLGVTLELWLLAGIVGTLLGLAVGVVRARGPRFFYPLTSAF 60 Query: 63 TYIFRGTPLYVQLLVFYSGMYTLEIVKGTEFLNAFFRSGLNCTVLALTLNTCAYTTEIFA 122 +FR TP+ +QL+ FY Y ++ G +F S LALTL T AY+TEIF Sbjct: 61 VEVFRNTPVLIQLIWFY---YAFPVLVGIQF------STFGAAALALTLYTAAYSTEIFR 111 Query: 123 GAIRSVPHGEIEAARAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATV 182 ++S+ G+ E A+A G M R IILP R LPA +N +I + T+LA TV Sbjct: 112 AGLQSIERGQWEGAKALGMPPGVMLRRIILPQVFRRMLPALTNRMIELAKVTSLASILTV 171 Query: 183 PDLLKIARDINAATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRWLQH 231 +L+ R +++ Y+P F + A+LY ++ + L R E+R+ H Sbjct: 172 NELMYQGRLLSSTWYRPVEIFTVVALLYFVLIWPGSYLAARLERRYRPH 220 Lambda K H 0.330 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 221 Length adjustment: 23 Effective length of query: 215 Effective length of database: 198 Effective search space: 42570 Effective search space used: 42570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory