Align Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate BWI76_RS09510 BWI76_RS09510 arginine transporter permease subunit ArtQ
Query= TCDB::Q9HU30 (231 letters) >FitnessBrowser__Koxy:BWI76_RS09510 Length = 238 Score = 176 bits (447), Expect = 3e-49 Identities = 96/226 (42%), Positives = 146/226 (64%), Gaps = 13/226 (5%) Query: 12 LLAGTWMTLKLSLAAVCVGLLLGLLGAIAKTSKYAALRFLGGTYTTIVRGVPETLWVLMI 71 L + MT+ L++ A+ +GL+L +L A+ ++ K + +L T++RG+PE L VL I Sbjct: 7 LASAAGMTVGLAVCALIIGLVLAMLFAVLESVKLRPIAWLATGIVTLLRGLPEILVVLFI 66 Query: 72 YFGTVSGLNALGDLFGK-------------PDLALSPFAAGTLALGLCFGAYATEVFRGA 118 YFG+ L L D F + +SPF G +AL L + AYA++ RGA Sbjct: 67 YFGSSQLLLTLSDGFTINLGFVQIPVQMQIENFDVSPFLCGAIALSLLYAAYASQTLRGA 126 Query: 119 LLSIPRGHREAGQALGLSPGRIFWRIVLPQIWRVALPGLGNLYLILLKDTALVSLITLDE 178 L ++P+G E+GQALGLS IF+R+V+PQ+WR ALPGLGN +L+LLKDTALVSLI++++ Sbjct: 127 LKAVPQGQWESGQALGLSKAAIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVSLISVND 186 Query: 179 IMRKAQVASNATKEPFTFYMTAAAIYLSLTVVIMVALHFLERRAGR 224 +M + + + T+EPF +Y+ AAAIYL +T++ L +++RA R Sbjct: 187 LMLQTKSIATRTQEPFNWYIIAAAIYLVITLLSQYILKRIDQRATR 232 Lambda K H 0.327 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 231 Length of database: 238 Length adjustment: 23 Effective length of query: 208 Effective length of database: 215 Effective search space: 44720 Effective search space used: 44720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory