Align ABC transporter for L-Histidine, permease component (characterized)
to candidate BWI76_RS22070 BWI76_RS22070 proline/betaine ABC transporter permease ProW
Query= reanno::pseudo5_N2C3_1:AO356_09615 (283 letters) >FitnessBrowser__Koxy:BWI76_RS22070 Length = 354 Score = 240 bits (613), Expect = 3e-68 Identities = 127/264 (48%), Positives = 179/264 (67%), Gaps = 1/264 (0%) Query: 13 WVNGWVDSLVTNYGDVFRHISDTLLWAIVNLEGLLRMAPWWLMLAIVGGIAWHATRKVLA 72 WV +D +V ++ +F+ I + + + + LL P + + I IAW + + Sbjct: 67 WVTHGIDWVVMHFRPLFQGIRVPVDYILSAFQQLLLGMPAPVAIIIFSLIAWQISSVGMG 126 Query: 73 TAVIVGLLFLVGAVGLWDKLMQTLALMLVATLISVLIGIPLGILSARSNRLRSVLMPLLD 132 A ++ L+ +GA+G W + M TLAL+L A L +LIG+PLGI ARS R ++ PLLD Sbjct: 127 AATLISLI-AIGAIGAWSQAMVTLALVLTALLFCMLIGLPLGIWLARSPRAAKIIRPLLD 185 Query: 133 IMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVMEAINAFG 192 MQT P+FVYL+P++MLFG+G VP + T+I+A PP++RLT LGI QV +++EA +FG Sbjct: 186 AMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQVPADLIEASRSFG 245 Query: 193 ANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQTLNVGR 252 A+ Q LF VQLPLA+P+IMAG+NQT M+ALSMVVIASMI GLG+ VL GI L++G Sbjct: 246 ASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGL 305 Query: 253 GLEAGLAIVILAVVIDRITQAYGR 276 G+ IVILA+++DR+TQA GR Sbjct: 306 ATVGGVGIVILAIILDRLTQAVGR 329 Lambda K H 0.328 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 354 Length adjustment: 27 Effective length of query: 256 Effective length of database: 327 Effective search space: 83712 Effective search space used: 83712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory