Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate BWI76_RS05990 BWI76_RS05990 branched-chain amino acid ABC transporter permease
Query= TCDB::P74318 (286 letters) >FitnessBrowser__Koxy:BWI76_RS05990 Length = 299 Score = 145 bits (367), Expect = 8e-40 Identities = 91/288 (31%), Positives = 165/288 (57%), Gaps = 18/288 (6%) Query: 5 QLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTS-----GINL 59 Q + NG+++G + AL A+G T+ YG+LRL NFAH D M + A+ T + +S G+ + Sbjct: 8 QQVVNGMSLGGMYALIAIGYTMVYGVLRLINFAHADVMMVGAFTTLFLFSSIGLPFGVAV 67 Query: 60 WLSMAL-GCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNN 118 +L++AL G G +I + + ++P+ R+A+ +++I +IG++ FL N +++GG++ Sbjct: 68 FLTLALCGLFGMLI-----DRVAYRPL--RQASKISMLITAIGVSFFLENLFNVLFGGSS 120 Query: 119 QNYRVP--IVPAQDFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDL 176 + + P + F + +V + + ++ + +L RT+ G A+RAVA +V+ Sbjct: 121 RFFSAPDFFNNTRAFGDVIITNVAWIVPLITVLLLLAILWLLYRTRYGMAIRAVAFDVNT 180 Query: 177 AKVSGINVEWVVMWTWVMTAVLTALGGSMYGL-MTTLKPNMGWFLILPMFASVILGGIGN 235 ++ GI+ ++ + + + L ALGG Y + T+ P MG + L FA+ +LGGIG+ Sbjct: 181 VRLMGIDANRIISLVFALGSSLAALGGVFYSISYPTIDPLMGVLIGLKAFAAAVLGGIGS 240 Query: 236 PYGAIAGGIIIGVAQEVSVPWFGT--SYKMGVALLLMIIILFIRPQGL 281 GA+ GG I+G + V+V F YK A + +I++L RP G+ Sbjct: 241 VTGAVLGGFILGFTEVVAVALFPELGGYKDAFAFMFLILVLLFRPVGI 288 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 299 Length adjustment: 26 Effective length of query: 260 Effective length of database: 273 Effective search space: 70980 Effective search space used: 70980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory