Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate BWI76_RS07265 BWI76_RS07265 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >FitnessBrowser__Koxy:BWI76_RS07265 Length = 239 Score = 181 bits (460), Expect = 9e-51 Identities = 97/237 (40%), Positives = 150/237 (63%), Gaps = 4/237 (1%) Query: 1 MSDLLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQG 60 MSDLL V + Y + ++ ++FS+ GE T+IG NGAGKS+ + I GL P G Sbjct: 1 MSDLLTVNQLSVHY-GGIQAVRDVSFSVKEGEQTTLIGANGAGKSSTVRAITGL-EPFSG 58 Query: 61 EIIFKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDR-- 118 EI+F G+ I ++ ++R G+ VP+ +F +TV ENL MGA+L + ++ Sbjct: 59 EILFNGKPIRKRRAESLLREGLVMVPEGRGIFARMTVLENLQMGAWLRRDAAAVKQEMGA 118 Query: 119 IYTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQ 178 I+ FP+LA+R++Q AG LSGGE+Q+LA+ RAL+ P LL+LDEPS L+P++V+++F Sbjct: 119 IFANFPRLAERQHQLAGLLSGGEQQLLALNRALLSQPRLLILDEPSMGLAPLMVENIFRV 178 Query: 179 IKAINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLG 235 I + G A++L+EQNA+ AL D +V+++G G Q+LL D + ++YLG Sbjct: 179 IATLRQRGVALLLIEQNARLALEATDSAWVMDSGSIVERGPSQTLLADDRIAQIYLG 235 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 239 Length adjustment: 23 Effective length of query: 217 Effective length of database: 216 Effective search space: 46872 Effective search space used: 46872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory