Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate BWI76_RS14160 BWI76_RS14160 ABC transporter substrate-binding protein
Query= metacyc::MONOMER-11683 (330 letters) >FitnessBrowser__Koxy:BWI76_RS14160 Length = 320 Score = 142 bits (358), Expect = 1e-38 Identities = 110/321 (34%), Positives = 156/321 (48%), Gaps = 9/321 (2%) Query: 11 LTDQEAVDMYRTMLLARKIDERMWLLNRSGKIP-FVISCQGQEAAQVGAAFALDREMDYV 69 L Q + YR M R +ER+ N SG IP F+ G+EA VG L D++ Sbjct: 3 LNKQALLQAYRKMREIRTFEERLHQENTSGDIPGFIHLYTGEEAIAVGVCENLTNA-DFI 61 Query: 70 LPYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSG-GRQMPGHFGQKKNRIVTGSSPVTTQ 128 +R G +A G +M F K + G G M H ++ ++ V Sbjct: 62 GSTHRGHGHCIAKGCDIHGMMAEIFGKDSGLCRGKGGSM--HIADLSKGMLGANAIVGGA 119 Query: 129 VPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAIS 188 P A+G AL + K G+G SNQG E N A V +LP IF+ ENN Y Sbjct: 120 PPLAIGAALTAKTLKTGNVGVSFTGDGGSNQGLVFEAINMAVVLQLPAIFIFENNGYGEG 179 Query: 189 VPYDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISYR 248 +D V +I+ RA G+G+P VTV+G D VY A EA +RAR G GP++IE ++R Sbjct: 180 TGHDYAVGGRDIAGRAAGFGLPAVTVDGTDFFAVYDATAEAVKRAREGGGPSVIEAKAFR 239 Query: 249 LTPHSSDDDDSSYRGREEVEEAKKS-DPLLTYQAYLKETGLLSDEIEQTMLDEIMAIVNE 307 H + D + YR EV+ ++ DPL + A +K+ +S E + E+ A+V++ Sbjct: 240 WHGH-FEGDPALYRAEGEVQRLREQHDPLKIFTARVKQH--ISLEELAAIDAEVEALVDD 296 Query: 308 ATDEAENAPYAAPESALDYVY 328 A +A A Y APE L VY Sbjct: 297 AVFKARAAAYPAPEDLLTDVY 317 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 320 Length adjustment: 28 Effective length of query: 302 Effective length of database: 292 Effective search space: 88184 Effective search space used: 88184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory