Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate BWI76_RS13120 BWI76_RS13120 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= curated2:P24162 (257 letters) >lcl|FitnessBrowser__Koxy:BWI76_RS13120 BWI76_RS13120 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase Length = 262 Score = 226 bits (575), Expect = 5e-64 Identities = 118/257 (45%), Positives = 164/257 (63%), Gaps = 10/257 (3%) Query: 9 EISEGLAVITLDRPEVMNALNAAMRHELTAALHRAR--GEARAIVLTGSGRAFCSGQDLG 66 E+ +G+ ITL+RP+ +N+ N M +L A L +A + R ++LTG+GR FC+GQDL Sbjct: 8 EVEQGVMTITLNRPDRLNSFNDLMHQQLAACLKQAERDDDVRCLLLTGAGRGFCAGQDLN 67 Query: 67 D------GAAEGLNLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLALAADVVI 120 D G A L L + Y PL++ + + P PV+ AVNG AAGAGA LAL D+V+ Sbjct: 68 DRNVDPSGPAPDLGLS--VERFYNPLVRRLAALPKPVICAVNGVAAGAGATLALGCDIVL 125 Query: 121 AAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWEAV 180 AA+SA F+ AF+++GL+PD GG+W+LPR G ARAMG+AL + + AE+AA+ G+IW+ V Sbjct: 126 AARSAKFVMAFSKLGLVPDCGGSWFLPRVAGRARAMGLALLGDSLSAEQAAQWGMIWQVV 185 Query: 181 PDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELGQSADFR 240 D + + A A HLA P+ +KKA + L QL LE Q G+SAD+R Sbjct: 186 DDAELKDTGLALARHLAAQPTYGLGLIKKALQLAETQTLDQQLDLERDYQRLAGRSADYR 245 Query: 241 EGVQAFLEKRPPHFTGR 257 EGV AFL KRPP F+G+ Sbjct: 246 EGVSAFLAKRPPQFSGK 262 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 262 Length adjustment: 24 Effective length of query: 233 Effective length of database: 238 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate BWI76_RS13120 BWI76_RS13120 (2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase)
to HMM TIGR02280 (paaB: phenylacetate degradation probable enoyl-CoA hydratase PaaB (EC 4.2.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02280.hmm # target sequence database: /tmp/gapView.25323.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02280 [M=256] Accession: TIGR02280 Description: PaaB1: phenylacetate degradation probable enoyl-CoA hydratase PaaB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-141 456.3 1.1 1.7e-141 456.1 1.1 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS13120 BWI76_RS13120 2-(1,2-epoxy-1,2-d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS13120 BWI76_RS13120 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.1 1.1 1.7e-141 1.7e-141 1 256 [] 5 262 .] 5 262 .] 0.99 Alignments for each domain: == domain 1 score: 456.1 bits; conditional E-value: 1.7e-141 TIGR02280 1 illelekgvlrltlnrpdklnsfteemhaelaealerverdd.vrallltGaGrGfcaGqdlsernvtkg. 69 il+e+e+gv+++tlnrpd+lnsf++ mh++la++l+++erdd vr+llltGaGrGfcaGqdl++rnv+++ lcl|FitnessBrowser__Koxy:BWI76_RS13120 5 ILSEVEQGVMTITLNRPDRLNSFNDLMHQQLAACLKQAERDDdVRCLLLTGAGRGFCAGQDLNDRNVDPSg 75 89**************************************999*************************998 PP TIGR02280 70 aapdlGetvekfynplvrrlaalpkpvvvavnGvaaGaGanlalagdivlaaesakfiqafaklGlipdsG 140 +apdlG +ve+fynplvrrlaalpkpv++avnGvaaGaGa+lal++divlaa+sakf++af+klGl+pd+G lcl|FitnessBrowser__Koxy:BWI76_RS13120 76 PAPDLGLSVERFYNPLVRRLAALPKPVICAVNGVAAGAGATLALGCDIVLAARSAKFVMAFSKLGLVPDCG 146 9********************************************************************** PP TIGR02280 141 GtwllprlvGrarakglallgekldaetaaewGliwqvvddealadevqalaahlakqptrglalikralq 211 G+w+lpr++Grara+glallg+ l+ae+aa+wG+iwqvvdd++l+d+ ala+hla+qpt gl+lik+alq lcl|FitnessBrowser__Koxy:BWI76_RS13120 147 GSWFLPRVAGRARAMGLALLGDSLSAEQAAQWGMIWQVVDDAELKDTGLALARHLAAQPTYGLGLIKKALQ 217 *********************************************************************** PP TIGR02280 212 aaetnsldtqldlerdlqrelGrsadyaeGvaafldkrepefkGk 256 aet++ld+qldlerd+qr +Grsady+eGv+afl+kr p+f Gk lcl|FitnessBrowser__Koxy:BWI76_RS13120 218 LAETQTLDQQLDLERDYQRLAGRSADYREGVSAFLAKRPPQFSGK 262 *******************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (256 nodes) Target sequences: 1 (262 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.12 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory