Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate BWI76_RS13120 BWI76_RS13120 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= curated2:P24162 (257 letters) >FitnessBrowser__Koxy:BWI76_RS13120 Length = 262 Score = 226 bits (575), Expect = 5e-64 Identities = 118/257 (45%), Positives = 164/257 (63%), Gaps = 10/257 (3%) Query: 9 EISEGLAVITLDRPEVMNALNAAMRHELTAALHRAR--GEARAIVLTGSGRAFCSGQDLG 66 E+ +G+ ITL+RP+ +N+ N M +L A L +A + R ++LTG+GR FC+GQDL Sbjct: 8 EVEQGVMTITLNRPDRLNSFNDLMHQQLAACLKQAERDDDVRCLLLTGAGRGFCAGQDLN 67 Query: 67 D------GAAEGLNLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLALAADVVI 120 D G A L L + Y PL++ + + P PV+ AVNG AAGAGA LAL D+V+ Sbjct: 68 DRNVDPSGPAPDLGLS--VERFYNPLVRRLAALPKPVICAVNGVAAGAGATLALGCDIVL 125 Query: 121 AAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWEAV 180 AA+SA F+ AF+++GL+PD GG+W+LPR G ARAMG+AL + + AE+AA+ G+IW+ V Sbjct: 126 AARSAKFVMAFSKLGLVPDCGGSWFLPRVAGRARAMGLALLGDSLSAEQAAQWGMIWQVV 185 Query: 181 PDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELGQSADFR 240 D + + A A HLA P+ +KKA + L QL LE Q G+SAD+R Sbjct: 186 DDAELKDTGLALARHLAAQPTYGLGLIKKALQLAETQTLDQQLDLERDYQRLAGRSADYR 245 Query: 241 EGVQAFLEKRPPHFTGR 257 EGV AFL KRPP F+G+ Sbjct: 246 EGVSAFLAKRPPQFSGK 262 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 262 Length adjustment: 24 Effective length of query: 233 Effective length of database: 238 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate BWI76_RS13120 BWI76_RS13120 (2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase)
to HMM TIGR02280 (paaB: phenylacetate degradation probable enoyl-CoA hydratase PaaB (EC 4.2.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02280.hmm # target sequence database: /tmp/gapView.30831.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02280 [M=256] Accession: TIGR02280 Description: PaaB1: phenylacetate degradation probable enoyl-CoA hydratase PaaB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-141 456.3 1.1 1.7e-141 456.1 1.1 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS13120 BWI76_RS13120 2-(1,2-epoxy-1,2-d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS13120 BWI76_RS13120 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.1 1.1 1.7e-141 1.7e-141 1 256 [] 5 262 .] 5 262 .] 0.99 Alignments for each domain: == domain 1 score: 456.1 bits; conditional E-value: 1.7e-141 TIGR02280 1 illelekgvlrltlnrpdklnsfteemhaelaealerverdd.vrallltGaGrGfcaGqdlsernvtkg. 69 il+e+e+gv+++tlnrpd+lnsf++ mh++la++l+++erdd vr+llltGaGrGfcaGqdl++rnv+++ lcl|FitnessBrowser__Koxy:BWI76_RS13120 5 ILSEVEQGVMTITLNRPDRLNSFNDLMHQQLAACLKQAERDDdVRCLLLTGAGRGFCAGQDLNDRNVDPSg 75 89**************************************999*************************998 PP TIGR02280 70 aapdlGetvekfynplvrrlaalpkpvvvavnGvaaGaGanlalagdivlaaesakfiqafaklGlipdsG 140 +apdlG +ve+fynplvrrlaalpkpv++avnGvaaGaGa+lal++divlaa+sakf++af+klGl+pd+G lcl|FitnessBrowser__Koxy:BWI76_RS13120 76 PAPDLGLSVERFYNPLVRRLAALPKPVICAVNGVAAGAGATLALGCDIVLAARSAKFVMAFSKLGLVPDCG 146 9********************************************************************** PP TIGR02280 141 GtwllprlvGrarakglallgekldaetaaewGliwqvvddealadevqalaahlakqptrglalikralq 211 G+w+lpr++Grara+glallg+ l+ae+aa+wG+iwqvvdd++l+d+ ala+hla+qpt gl+lik+alq lcl|FitnessBrowser__Koxy:BWI76_RS13120 147 GSWFLPRVAGRARAMGLALLGDSLSAEQAAQWGMIWQVVDDAELKDTGLALARHLAAQPTYGLGLIKKALQ 217 *********************************************************************** PP TIGR02280 212 aaetnsldtqldlerdlqrelGrsadyaeGvaafldkrepefkGk 256 aet++ld+qldlerd+qr +Grsady+eGv+afl+kr p+f Gk lcl|FitnessBrowser__Koxy:BWI76_RS13120 218 LAETQTLDQQLDLERDYQRLAGRSADYREGVSAFLAKRPPQFSGK 262 *******************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (256 nodes) Target sequences: 1 (262 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.69 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory