GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadA in Klebsiella michiganensis M5al

Align 3-ketoacyl-CoA thiolase FadI; ACSs; Acetyl-CoA acyltransferase; Acyl-CoA ligase; Beta-ketothiolase; Fatty acid oxidation complex subunit beta; EC 2.3.1.16 (characterized)
to candidate BWI76_RS20460 BWI76_RS20460 acetyl-CoA C-acyltransferase FadI

Query= SwissProt::P76503
         (436 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS20460 BWI76_RS20460 acetyl-CoA
           C-acyltransferase FadI
          Length = 436

 Score =  758 bits (1958), Expect = 0.0
 Identities = 385/436 (88%), Positives = 413/436 (94%)

Query: 1   MGQVLPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPAEVIE 60
           M Q LPLVTRQGDRIAIVSGLRTPFARQATAFHG+PAVDLGK+VVGE+LARS IPA++IE
Sbjct: 1   MSQALPLVTRQGDRIAIVSGLRTPFARQATAFHGVPAVDLGKLVVGEMLARSTIPADIIE 60

Query: 61  QLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRA 120
           QLVFGQVVQMPEAPNIAREIVLGTGM+VHTDAYSVSRACATSFQAVANVAESLMAGTIRA
Sbjct: 61  QLVFGQVVQMPEAPNIAREIVLGTGMSVHTDAYSVSRACATSFQAVANVAESLMAGTIRA 120

Query: 121 GIAGGADSSSVLPIGVSKKLARVLVDVNKARTMSQRLKLFSRLRLRDLMPVPPAVAEYST 180
           GIAGGADSSSVLPIGVSKKLAR LVD NKART+ QRLKLFSRLR RDL+PVPPAVAEYST
Sbjct: 121 GIAGGADSSSVLPIGVSKKLARTLVDANKARTLGQRLKLFSRLRFRDLLPVPPAVAEYST 180

Query: 181 GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWSDGKLKEEVMTAFIPPYKQPLVE 240
           GLRMGDTAEQMAKT+GITRE+QDALA RSHQ AA+AW +GKL  EVMTA+ PP+++PL +
Sbjct: 181 GLRMGDTAEQMAKTWGITRERQDALALRSHQLAAKAWEEGKLSAEVMTAYTPPFREPLEQ 240

Query: 241 DNNIRGNSSLADYAKLRPAFDRKHGTVTAANSTPLTDGAAAVILMTESRAKELGLVPLGY 300
           DNNIR NS+LADY KLRPAFDR+HG+VTAANSTPLTDGAAAVILMTESRAKELGLVPLGY
Sbjct: 241 DNNIRKNSTLADYQKLRPAFDRQHGSVTAANSTPLTDGAAAVILMTESRAKELGLVPLGY 300

Query: 301 LRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMSDLTLIDMHEAFAAQTLANIQLLGSE 360
           LRSYAFTAIDV QDMLLGPAWSTPLALERAGLT++DLTLIDMHEAFAAQTLAN+  + S+
Sbjct: 301 LRSYAFTAIDVRQDMLLGPAWSTPLALERAGLTLADLTLIDMHEAFAAQTLANLHCMASD 360

Query: 361 RFAREALGRAHATGEVDDSKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT 420
           RFARE LGR+ A GEVD+SKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
Sbjct: 361 RFAREVLGRSQAIGEVDESKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT 420

Query: 421 ACAAGGLGAAMVLEAE 436
           ACAAGGLG+AMVLEAE
Sbjct: 421 ACAAGGLGSAMVLEAE 436


Lambda     K      H
   0.319    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 702
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 436
Length of database: 436
Length adjustment: 32
Effective length of query: 404
Effective length of database: 404
Effective search space:   163216
Effective search space used:   163216
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate BWI76_RS20460 BWI76_RS20460 (acetyl-CoA C-acyltransferase FadI)
to HMM TIGR02446 (fadI: acetyl-CoA C-acyltransferase FadI (EC 2.3.1.16))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02446.hmm
# target sequence database:        /tmp/gapView.8879.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02446  [M=430]
Accession:   TIGR02446
Description: FadI: acetyl-CoA C-acyltransferase FadI
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                               -----------
   8.7e-262  854.5   3.4   9.7e-262  854.3   3.4    1.0  1  lcl|FitnessBrowser__Koxy:BWI76_RS20460  BWI76_RS20460 acetyl-CoA C-acylt


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Koxy:BWI76_RS20460  BWI76_RS20460 acetyl-CoA C-acyltransferase FadI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  854.3   3.4  9.7e-262  9.7e-262       1     430 []       7     436 .]       7     436 .] 1.00

  Alignments for each domain:
  == domain 1  score: 854.3 bits;  conditional E-value: 9.7e-262
                               TIGR02446   1 vktrqgeriaivaglrtpfarqatafhgipavdlgkmvvsellarseidaklieqlvfgqvvqmpeapnia 71 
                                             ++trqg+riaiv+glrtpfarqatafhg+pavdlgk+vv+e+lars i+a++ieqlvfgqvvqmpeapnia
  lcl|FitnessBrowser__Koxy:BWI76_RS20460   7 LVTRQGDRIAIVSGLRTPFARQATAFHGVPAVDLGKLVVGEMLARSTIPADIIEQLVFGQVVQMPEAPNIA 77 
                                             589******************************************************************** PP

                               TIGR02446  72 reivlgtgmnvhtdaysvtracatsfqsavnvaesimagaieigiaggadsssvlpigvskklaralvdln 142
                                             reivlgtgm vhtdaysv+racatsfq+++nvaes+mag+i++giaggadsssvlpigvskklar+lvd n
  lcl|FitnessBrowser__Koxy:BWI76_RS20460  78 REIVLGTGMSVHTDAYSVSRACATSFQAVANVAESLMAGTIRAGIAGGADSSSVLPIGVSKKLARTLVDAN 148
                                             *********************************************************************** PP

                               TIGR02446 143 kartlgqklkvlsrlglkdllpvppavaeystglsmgqtaeqmaktygitraeqdalahrshtlaaqawad 213
                                             kartlgq+lk++srl+++dllpvppavaeystgl+mg+taeqmakt+gitr+ qdala rsh+laa+aw++
  lcl|FitnessBrowser__Koxy:BWI76_RS20460 149 KARTLGQRLKLFSRLRFRDLLPVPPAVAEYSTGLRMGDTAEQMAKTWGITRERQDALALRSHQLAAKAWEE 219
                                             *********************************************************************** PP

                               TIGR02446 214 gklkeevmtafvepykkfiaednnirenssladyaklrpafdrkygsvtaanstpltdgaaavilmsegra 284
                                             gkl  evmta+++p+++++++dnnir+ns+lady klrpafdr++gsvtaanstpltdgaaavilm+e+ra
  lcl|FitnessBrowser__Koxy:BWI76_RS20460 220 GKLSAEVMTAYTPPFREPLEQDNNIRKNSTLADYQKLRPAFDRQHGSVTAANSTPLTDGAAAVILMTESRA 290
                                             *********************************************************************** PP

                               TIGR02446 285 kelgleilgyirsyaftaidveqdmllgpsyatplalkraglelsdltlidmheafaaqtlanvkllasek 355
                                             kelgl++lgy+rsyaftaidv qdmllgp+++tplal+ragl+l dltlidmheafaaqtlan++ +as++
  lcl|FitnessBrowser__Koxy:BWI76_RS20460 291 KELGLVPLGYLRSYAFTAIDVRQDMLLGPAWSTPLALERAGLTLADLTLIDMHEAFAAQTLANLHCMASDR 361
                                             *********************************************************************** PP

                               TIGR02446 356 faeeklgrakaigeidmskfnvlggsiayghpfaatgarlitqtlrelkrrggglglatacaagglgaami 426
                                             fa+e lgr++aige+d+skfnvlggsiayghpfaatgar+itqtl+el+rrggg+gl+tacaagglg+am+
  lcl|FitnessBrowser__Koxy:BWI76_RS20460 362 FAREVLGRSQAIGEVDESKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVTACAAGGLGSAMV 432
                                             *********************************************************************** PP

                               TIGR02446 427 leve 430
                                             le+e
  lcl|FitnessBrowser__Koxy:BWI76_RS20460 433 LEAE 436
                                             **97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (430 nodes)
Target sequences:                          1  (436 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 11.78
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory