Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate BWI76_RS13985 BWI76_RS13985 urea carboxylase
Query= metacyc::MONOMER-13597 (509 letters) >FitnessBrowser__Koxy:BWI76_RS13985 Length = 1201 Score = 328 bits (840), Expect = 9e-94 Identities = 180/447 (40%), Positives = 266/447 (59%), Gaps = 3/447 (0%) Query: 4 FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63 F +L+ANRG IA R+L+ ++ M + +AVYSEAD ++H + ADEA +G PA +YL Sbjct: 2 FDTLLIANRGAIACRILRTLRAMQVKGVAVYSEADLSSLHIRDADEALSLGDGPAAQTYL 61 Query: 64 NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123 E II AA+++ AIHPGYGFLSENA FAEA E AG+ F+GP+ +R K + Sbjct: 62 ATEKIIAAAQQSGARAIHPGYGFLSENAAFAEACEAAGLAFVGPTPRQLRVFGLKHTARA 121 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183 LA GVP GS+ S DEA + AE +GYP+M+K+ +GGGG+G+ + +L + + Sbjct: 122 LAKAEGVPLLEGSELLADS-DEACRAAEAVGYPVMLKSTAGGGGIGMRVCRDARELTEAF 180 Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243 +RL F A +F+EKY RH+E Q+ GD G+ + R+C++QRRNQK+IEE Sbjct: 181 ATVQRLGQNNFSDAGVFLEKYIERARHLEVQIFGDGRGDVIALGVRDCSVQRRNQKVIEE 240 Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTT 303 P+P L +++ I GK ++Y + GT E + +R FYFLE+N RLQVEH T Sbjct: 241 TPAPNLPEGTAQALCAAAIALGKAVSYRSAGTVEFVYDSTARQFYFLEVNTRLQVEHGVT 300 Query: 304 ELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVT-- 361 E ++ +DLV+ I+LAAG+ P R +G AI+ R+ AED F S G +T Sbjct: 301 EQVWGVDLVRWMIELAAGDLPPLDVLAAGLRPQGHAIQARLYAEDPGRQFQPSPGLLTEA 360 Query: 362 YYREPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGIK 421 + G +R+D +E+G VPP++D +++K I + SR+ AI +ALA+ ++ G++ Sbjct: 361 IFPPADGAALRIDRWVEAGCEVPPFFDPMLAKTIAWRPSRDEAIAGLAQALAETRLYGVE 420 Query: 422 TTIELYKWIMQDPDFQEGKFSTSYISQ 448 T I+ F EG+ T + Q Sbjct: 421 TNRLYLLQILGFAPFTEGEPWTRCLEQ 447 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1278 Number of extensions: 57 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 1201 Length adjustment: 41 Effective length of query: 468 Effective length of database: 1160 Effective search space: 542880 Effective search space used: 542880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory