Align 2-dehydro-3-deoxygalactonokinase (EC 2.7.1.58) (characterized)
to candidate BWI76_RS27945 BWI76_RS27945 2-oxo-3-deoxygalactonate kinase
Query= BRENDA::A6TFZ6 (292 letters) >FitnessBrowser__Koxy:BWI76_RS27945 Length = 291 Score = 448 bits (1152), Expect = e-131 Identities = 218/292 (74%), Positives = 256/292 (87%), Gaps = 1/292 (0%) Query: 1 MTARYIAIDWGSTNLRAWLYQGEECLESRQSEAGVTRLNGRSPAAVLAEITQHWRDGATP 60 MT+RYIAIDWGSTNLRAWLYQ ++CLESRQS AGVTRLNG SPAAV +EIT+ WRDGATP Sbjct: 1 MTSRYIAIDWGSTNLRAWLYQDDQCLESRQSAAGVTRLNGESPAAVFSEITRGWRDGATP 60 Query: 61 VVMAGMVGSNVGWKIAPYLPLPAAFSDIGQQLTAVGDNIWIIPGLCVSRDDNHNVMRGEE 120 V+AGMVGSNVGWK+APYLP+P FS IGQQLT+VGD +WIIPGL VSRD N NVMRGEE Sbjct: 61 AVLAGMVGSNVGWKVAPYLPVPVDFSAIGQQLTSVGDKVWIIPGLSVSRDANQNVMRGEE 120 Query: 121 TQLLGARALAPSSVYVMPGTHCKWVLADRRQIHDFRTVLTGELHHLLLQLSLVGAGLPPQ 180 TQLLGAR +APSS+YVMPGTHCKWV ADR+QI+DFRTV+TGELH+LLL+ SLVGAGLP Q Sbjct: 121 TQLLGARMIAPSSIYVMPGTHCKWVQADRQQINDFRTVMTGELHYLLLRHSLVGAGLPEQ 180 Query: 181 ETSAAAFAAGLQRGINNPAVLPQLFEVRASHVLGALPREQVSEFLSGLLIGAEVATLSDT 240 ++ AF AGL+RG+++P +LP+LFEVRASHVLG+LPREQV EFLSGLLIGAEVATLS+ Sbjct: 181 VSAPGAFNAGLERGLHSPDILPRLFEVRASHVLGSLPREQVGEFLSGLLIGAEVATLSER 240 Query: 241 FAGQQAISLVAGSSLTSRYQQAFAAIGREVSAVAGDTAFQTGIRSIAYAVAN 292 F Q +++V G +L +RYQQA +AIGR+ + V+GD AFQTG+RSI +AVAN Sbjct: 241 FRDPQ-VTIVGGEALANRYQQALSAIGRQTTVVSGDNAFQTGVRSIIHAVAN 291 Lambda K H 0.319 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 291 Length adjustment: 26 Effective length of query: 266 Effective length of database: 265 Effective search space: 70490 Effective search space used: 70490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory