Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate BWI76_RS11775 BWI76_RS11775 2-deoxy-D-gluconate 3-dehydrogenase
Query= SwissProt::Q92RN6 (256 letters) >FitnessBrowser__Koxy:BWI76_RS11775 Length = 253 Score = 132 bits (333), Expect = 5e-36 Identities = 83/246 (33%), Positives = 134/246 (54%), Gaps = 4/246 (1%) Query: 10 DLRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQTGQAPHFIQ 69 DL + +VTG +G+G + A+ G + V+ A EKV A G+ IQ Sbjct: 7 DLAGKVAIVTGCDTGLGQGMTLGLAQAGCDIVGVNRRIPHETA--EKVQA-LGRRFTAIQ 63 Query: 70 ADLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLSVNLRHLFFM 129 ADL + + +AVA +G + +LVNNA R + +E+ WD+ +++NL+ +FF+ Sbjct: 64 ADLSRQDEIEDIVTQAVAAMGRIDILVNNAGTIRRADALSFSEKDWDDVMNLNLKSVFFL 123 Query: 130 CQAVAPHMQRQG-GGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGPDNIRV 188 QAVA +QG GG IVN +S+ +P+Y+ +K+G++G+T+ +A + I V Sbjct: 124 SQAVARQFIQQGDGGKIVNIASMLSFQGGIRVPSYTASKSGVLGITRLMANEWAGHRINV 183 Query: 189 NAILPGMIVTERQRRLWLTEESIARMQERQCLKRMLVADDLVGPCLFLASDSSAAMTAQA 248 NAI PG + T ++L E + +R R VADDL GP +FLAS ++ ++ Sbjct: 184 NAIAPGYMATNNTQQLRDDAERSKAILDRIPAGRWGVADDLQGPVVFLASRAADYISGYT 243 Query: 249 MIIDGG 254 + +DGG Sbjct: 244 LAVDGG 249 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 253 Length adjustment: 24 Effective length of query: 232 Effective length of database: 229 Effective search space: 53128 Effective search space used: 53128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory