Align D-tagatose-1,6-bisphosphate aldolase subunit GatY; TBPA; TagBP aldolase; D-tagatose-bisphosphate aldolase class II; Tagatose-bisphosphate aldolase; EC 4.1.2.40 (characterized)
to candidate BWI76_RS11550 BWI76_RS11550 hypothetical protein
Query= SwissProt::P0C8J6 (284 letters) >FitnessBrowser__Koxy:BWI76_RS11550 Length = 278 Score = 173 bits (438), Expect = 4e-48 Identities = 100/234 (42%), Positives = 137/234 (58%), Gaps = 1/234 (0%) Query: 11 NNAQRGGYAVPAFNIHNLETMQVVVETAANLHAPVIIAGTPGTFTHAGTENLLALVSAMA 70 N+A+ YA+ FN+ N E + V++ A +PVII+ G + E+ ++ +MA Sbjct: 10 NDARNKHYAIAHFNVWNAEMLMGVIDAAEEAKSPVIISFGTGFVGNTSFEDFSHMMVSMA 69 Query: 71 KQYHHPLAIHLDHHTKFDDIAQKVRSGVRSVMIDASHLPFAQNISRVKEVVDFCHRFDVS 130 K+ P+ H DH + I G+ S+M DAS F +NI KE VDF H + Sbjct: 70 KKASVPVIAHWDHGRSMEIIHNAWVHGMNSLMRDASAFDFEENIRLTKEAVDFFHPLGIP 129 Query: 131 VEAELGQLGGQEDDVQVNEADALYTNPAQAREFAEATGIDSLAVAIGTAHGMYASAPALD 190 VEAELG +G E + AD YT+P QA EF E TG DSLAVAIG HG+Y S P L+ Sbjct: 130 VEAELGHVGN-ETVYEEALADYHYTDPDQAAEFVERTGCDSLAVAIGNQHGVYTSEPKLN 188 Query: 191 FSRLENIRQWVNLPLVLHGASGLSTKDIQQTIKLGICKINVATELKNAFSQALK 244 F ++ +R+ V +PLVLHGASG+S DI++ I LGI KIN+ TEL A A++ Sbjct: 189 FDVVKRVREAVAVPLVLHGASGISDADIKKAISLGIAKINIHTELCQAAMAAVQ 242 Lambda K H 0.318 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 278 Length adjustment: 26 Effective length of query: 258 Effective length of database: 252 Effective search space: 65016 Effective search space used: 65016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory