Align LacF, component of Lactose porter (characterized)
to candidate BWI76_RS23380 BWI76_RS23380 sugar ABC transporter permease
Query= TCDB::P29823 (298 letters) >FitnessBrowser__Koxy:BWI76_RS23380 Length = 296 Score = 158 bits (399), Expect = 2e-43 Identities = 99/284 (34%), Positives = 164/284 (57%), Gaps = 14/284 (4%) Query: 17 GWLFVAPAIALISVFMLYPILRSLVLSLYTGRGMMLK--FSGTGNL-VRLWNDPVFWQAL 73 G +++P I + VF +P + S LS +T +M F+G N L D +FW+++ Sbjct: 8 GLAWISPYIIGLIVFTAFPFVSSFFLS-FTEYDLMSPPVFNGIENYRYMLTEDGLFWKSM 66 Query: 74 QNTVIFFVVQVPIMITMALILAAMLNNPKLRYSGLFRTMIFLPCV-SSLVAYSILFKSMF 132 T + + +P+ + AL +A +LN KLR G FRT ++P + S VA ++L++++F Sbjct: 67 GVTFAYVFLTIPLKLAFALGIAFVLNF-KLRGIGFFRTAYYIPSILGSSVAIAVLWRALF 125 Query: 133 SLDGVVNNTLLAIGIIG-EPIGWLTDPFWAKVLIIIAITWRWTGYNMIFYLAALQNIDRS 191 ++DG++N+ IG++G +P+ WL +P A + + + W++ G M+ +LAALQN+ +S Sbjct: 126 AIDGLLNSF---IGVLGFDPVNWLGEPSLALMSVTLLRVWQF-GSAMVIFLAALQNVPQS 181 Query: 192 IYEAAKIDGVPSWGRFAFLTIPMLKPVILFTTITSTIGTLQLFDEVYNFTEGTGGPANST 251 YEAA IDG W F +T+P++ PVI F I T Q F Y T GGP ST Sbjct: 182 QYEAAMIDGASKWQMFMKVTVPLITPVIFFNFIMQTTQAFQEFTGPYVIT--GGGPTYST 239 Query: 252 LTLSLYIYNLTFRFMPSFSYAATVSYVIVLMVAVLSFLQFYAAR 295 SLYIY+ F++ Y A +++V+ L+VAV + + F +++ Sbjct: 240 YLFSLYIYDTAFKYF-DMGYGAALAWVLFLVVAVFAAIAFKSSK 282 Lambda K H 0.329 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 296 Length adjustment: 26 Effective length of query: 272 Effective length of database: 270 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory