Align PTS lactose transporter subunit IIA, component of PTS-type lactose transporter, IIC-IIB-IIA (characterized)
to candidate BWI76_RS27755 BWI76_RS27755 molecular chaperone TorD
Query= TCDB::U5MLJ3 (105 letters) >FitnessBrowser__Koxy:BWI76_RS27755 Length = 100 Score = 89.4 bits (220), Expect = 1e-23 Identities = 41/100 (41%), Positives = 66/100 (66%) Query: 1 MEDLETIIMELLVNAGSARSAALTALQLARKGDFAAAEQAMAESHEFVKHAHKIQTQLIG 60 M +LE +ME++VNAG +RS AL AR G+ A + E+ + + AH++QT+LI Sbjct: 1 MIELEDAVMEIIVNAGQSRSLCFEALHCARNGNIDEARLLLNEADGYARRAHQMQTRLIE 60 Query: 61 MDEGSGKLPVNLITVHSQDHLMNAMVIQDLATDMIELYRR 100 D G + P+ LI VH+QDHLMN+++ ++ + ++I LY+R Sbjct: 61 QDAGEARQPMTLIMVHAQDHLMNSLLAREFSEELIHLYQR 100 Lambda K H 0.319 0.130 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 48 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 105 Length of database: 100 Length adjustment: 11 Effective length of query: 94 Effective length of database: 89 Effective search space: 8366 Effective search space used: 8366 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory