Align 6-P-β-galactosidase (Gan1D) (EC 3.2.1.86) (characterized)
to candidate BWI76_RS16340 BWI76_RS16340 aryl-phospho-beta-D-glucosidase
Query= CAZy::AHL67640.1 (478 letters) >FitnessBrowser__Koxy:BWI76_RS16340 Length = 456 Score = 429 bits (1103), Expect = e-124 Identities = 223/470 (47%), Positives = 285/470 (60%), Gaps = 19/470 (4%) Query: 9 FPPEFLWGAASAAYQVEGAWNEDGKGLSVWDVFAKQPGRTFKGTNGDVAVDHYHRYQEDV 68 FP FLWGAA+AA+QVEG + DGKG S+WD ++ PG T++GT GD+AVDHYHR++EDV Sbjct: 4 FPQHFLWGAATAAWQVEGGHDADGKGPSIWDTYSHLPGTTYQGTTGDIAVDHYHRFREDV 63 Query: 69 ALMAEMGLKAYRFSVSWSRVFPDGNGAVNEKGLDFYDRLIEELRNHGIEPIVTLYHWDVP 128 ALMAEMGL++YRFS+SW R+ P G G VNE G+ FY LI+EL H IEP++TLYHWD+P Sbjct: 64 ALMAEMGLQSYRFSISWPRLLPTGRGEVNEAGVQFYSDLIDELLAHNIEPMITLYHWDLP 123 Query: 129 QALMDAYGAWESRRIIDDFDRYAVTLFQRFGDRVKYWVTLNEQNIFISFGYRLGLHPPGV 188 QAL D G WE+R F YA +QRFG RVK W T NE +FI GY G+HPP V Sbjct: 124 QALQDE-GGWEARSTAQAFAEYARLCYQRFGSRVKLWATFNETIVFIGHGYINGIHPPAV 182 Query: 189 KDMKRMYEANHIANLANAKVIQSFRHYVPDGKIGPSFAYSPMYPYDSRPENVLAFENAEE 248 +D R +A H +A+A +++FR G+IG P + A E A+ Sbjct: 183 RDPARAIQACHHVFIAHALAVKAFREMGVAGEIGFVNVLQPHTALTDSEADKQATEMADA 242 Query: 249 FQNHWWMDVYAWGMYPQAAWNYLESQGLEPTVAPGDWELLQAAKPDFMGVNYYQTTTVEH 308 HW D G YP ++ P PGD LL+ + DF+G+NYY+ TV Sbjct: 243 IHTHWLYDPVLKGGYPAELLQKTQALWGVPAFEPGDDALLRDNRCDFIGLNYYRRETVSA 302 Query: 309 NPPDGVGEGVMNTTGKKGTSTSSGIPGLFKTVRNPHVDTTNWDWAIDPVGLRIGLRRIAN 368 PP+ T G+ GLF VRNP T W W I P GL G+ I Sbjct: 303 QPPE------------VATGGEPGVDGLFYFVRNPQSTYTEWGWEIWPQGLTDGIMMIKA 350 Query: 369 RY-QLPILITENGLGEFDTLEPGDIVNDDYRIDYLRRHVQEIQRAITDGVDVLGYCAWSF 427 RY +PI ITENGLG D + G+IV DD RIDYL H+ +++A+ G DV GY WSF Sbjct: 351 RYGDIPIYITENGLGAVDPIINGEIV-DDPRIDYLSSHITALEKALELGADVRGYYPWSF 409 Query: 428 TDLLSWLNGYQKRYGFVYVNRDDESEKDLRRIKKKSFYWYQRVIETNGAE 477 DLLSWLNGY+K+YGFVYV + +++L R +KKSF+WYQ VI + G + Sbjct: 410 IDLLSWLNGYKKQYGFVYV----DHQQNLARKRKKSFFWYQNVIASRGEQ 455 Lambda K H 0.320 0.139 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 817 Number of extensions: 33 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 478 Length of database: 456 Length adjustment: 33 Effective length of query: 445 Effective length of database: 423 Effective search space: 188235 Effective search space used: 188235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory