GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdC in Klebsiella michiganensis M5al

Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate BWI76_RS04885 BWI76_RS04885 pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase

Query= reanno::Smeli:SMc03203
         (426 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS04885 BWI76_RS04885 pyruvate
           dehydrogenase complex dihydrolipoyllysine-residue
           acetyltransferase
          Length = 629

 Score =  228 bits (582), Expect = 3e-64
 Identities = 145/432 (33%), Positives = 221/432 (51%), Gaps = 39/432 (9%)

Query: 6   IKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVG 65
           + +PD+G    E E+ E  VK GD +  +  L  V  DKA++E+P+P  G V  +    G
Sbjct: 208 VHVPDIGGD--EVEVTEVMVKVGDKIAAEQSLITVEGDKASMEVPAPFAGTVKEIKISTG 265

Query: 66  DTVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSRLEAKAPPQPEKPAPKP 125
           D V+  + ++  E  G A  AAP                A ++   A AP Q  KPA  P
Sbjct: 266 DKVSTGSLIMVFEVEGAAPAAAP----------------AAAAPAPAAAPAQAAKPAAAP 309

Query: 126 APAPR---EAPDLSAKPLASPAVRLRARESGIDLRQVAGTGPAGRITHEDLDLFISRG-- 180
           A       E  +  A   A+P +R  ARE G++L +V G+G  GRI  ED+  ++     
Sbjct: 310 AAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGSGRKGRILREDVQAYVKEAVK 369

Query: 181 -AEPLPAQTG-------------LVRKTAVEEVRMIGLRRRIAEKMSLSTSRIPHITYVE 226
            AE  PA TG               +   VEEV +  +++     +S +   IPH+T+ +
Sbjct: 370 RAEAAPAATGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVMIPHVTHFD 429

Query: 227 EVDMTALEDLRATMNRDRKPEQ--AKLTILPFLMRALVKTVAEQPGVNATFDDHAGVIHR 284
           + D+T LE  R   N + +  +   K T + F+M+A+   + + P  N++  + A  +  
Sbjct: 430 KTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFNSSLSEDAQRLTL 489

Query: 285 HAAVHIGIATQTPAGLTVPVVRHAEARGIWDCAAELNRLADAARTGTATRDELTGSTITI 344
              ++IG+A  TP GL VPV +    + I + + EL  ++  AR G  T  E+ G   TI
Sbjct: 490 KKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTVISKKARDGKLTAGEMQGGCFTI 549

Query: 345 SSLGAIGGIASTPVINHPEVAIVGVNKIAVRPVWDGAQFVPRKIMNLSSSFDHRVIDGWD 404
           SS+G +G     P++N PEVAI+GV+K A+ PVW+G +FVPR +M +S SFDHRVIDG D
Sbjct: 550 SSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFDHRVIDGAD 609

Query: 405 AAVFVQRLKTLL 416
            A F+  +  +L
Sbjct: 610 GARFITIINNML 621



 Score = 55.8 bits (133), Expect = 4e-12
 Identities = 36/104 (34%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

Query: 6   IKMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVG 65
           IK+PD+G    E E+ E  VK GD V  +  L  V  DKA++E+PSP  G V  +   VG
Sbjct: 5   IKVPDIGAD--EVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVSVG 62

Query: 66  DTVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSR 109
           D       ++  ++A  A  AAP    +  A      P A S++
Sbjct: 63  DKTETGKLIMIFDSADGAAAAAPAQEEKKEAAPAAAAPAAASAK 106


Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 636
Number of extensions: 19
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 426
Length of database: 629
Length adjustment: 35
Effective length of query: 391
Effective length of database: 594
Effective search space:   232254
Effective search space used:   232254
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory