GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ilvE in Klebsiella michiganensis M5al

Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate BWI76_RS00970 BWI76_RS00970 branched chain amino acid aminotransferase

Query= BRENDA::P0AB80
         (309 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS00970 BWI76_RS00970 branched chain
           amino acid aminotransferase
          Length = 309

 Score =  610 bits (1574), Expect = e-179
 Identities = 296/309 (95%), Positives = 306/309 (99%)

Query: 1   MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR 60
           MTTKKADYIWFNGEMV W +AKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR
Sbjct: 1   MTTKKADYIWFNGEMVPWGEAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR 60

Query: 61  LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDV 120
           LHDSAKIYRFPVSQS+DELMEACR+VIRKN+LTSAYIRPL+FVGDVGMGVNPP GY+TDV
Sbjct: 61  LHDSAKIYRFPVSQSVDELMEACREVIRKNSLTSAYIRPLVFVGDVGMGVNPPPGYNTDV 120

Query: 121 IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY 180
           IIAAFPWGAYLGAEAL+QGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY
Sbjct: 121 IIAAFPWGAYLGAEALDQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY 180

Query: 181 QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQ 240
           QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAK+LG+EVREQ
Sbjct: 181 QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKDLGLEVREQ 240

Query: 241 VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDK 300
           VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGP+TKRIQQAFFGLFTGETEDK
Sbjct: 241 VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPITKRIQQAFFGLFTGETEDK 300

Query: 301 WGWLDQVNQ 309
           WGWLDQVNQ
Sbjct: 301 WGWLDQVNQ 309


Lambda     K      H
   0.319    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 496
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 309
Length of database: 309
Length adjustment: 27
Effective length of query: 282
Effective length of database: 282
Effective search space:    79524
Effective search space used:    79524
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate BWI76_RS00970 BWI76_RS00970 (branched chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01122.hmm
# target sequence database:        /tmp/gapView.3301.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01122  [M=298]
Accession:   TIGR01122
Description: ilvE_I: branched-chain amino acid aminotransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                               -----------
   5.8e-149  481.1   0.0   6.5e-149  481.0   0.0    1.0  1  lcl|FitnessBrowser__Koxy:BWI76_RS00970  BWI76_RS00970 branched chain ami


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Koxy:BWI76_RS00970  BWI76_RS00970 branched chain amino acid aminotransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  481.0   0.0  6.5e-149  6.5e-149       1     298 []      10     307 ..      10     307 .. 1.00

  Alignments for each domain:
  == domain 1  score: 481.0 bits;  conditional E-value: 6.5e-149
                               TIGR01122   1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskeelv 71 
                                             w++Ge+v++ +akvhv++halhYGt+vfeGiR+Y+++kg+++fr++eh++Rl+dsaki+r+++++s +el+
  lcl|FitnessBrowser__Koxy:BWI76_RS00970  10 WFNGEMVPWGEAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQSVDELM 80 
                                             9********************************************************************** PP

                               TIGR01122  72 evtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssfrraa 142
                                             e+++ev+rkn l+saYiRplv+vG+ ++g++p+ +++++viiaa++wgaylg+eal++Gi+++vss++raa
  lcl|FitnessBrowser__Koxy:BWI76_RS00970  81 EACREVIRKNSLTSAYIRPLVFVGDVGMGVNPPPGYNTDVIIAAFPWGAYLGAEALDQGIDAMVSSWNRAA 151
                                             *********************************************************************** PP

                               TIGR01122 143 vnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvsesiLkgit 213
                                             +n+ipt+aka+gnYl+sll++sea+r+Gy+e+i+Ld +Gy++eG+Gen+f vkdgvl+tPp+++s+L git
  lcl|FitnessBrowser__Koxy:BWI76_RS00970 152 PNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGIT 222
                                             *********************************************************************** PP

                               TIGR01122 214 rdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkklqeaffdlv 284
                                             rda+iklak+lg+ev+e+++sre+ly+aDevf++Gtaae+tP+r+vDg+++geg++Gp+tk++q+aff l+
  lcl|FitnessBrowser__Koxy:BWI76_RS00970 223 RDAIIKLAKDLGLEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPITKRIQQAFFGLF 293
                                             *********************************************************************** PP

                               TIGR01122 285 egktekkeewltyv 298
                                             +g+te+k++wl++v
  lcl|FitnessBrowser__Koxy:BWI76_RS00970 294 TGETEDKWGWLDQV 307
                                             ***********987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (298 nodes)
Target sequences:                          1  (309 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 6.70
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory