Align aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 (characterized)
to candidate BWI76_RS09870 BWI76_RS09870 aromatic amino acid aminotransferase
Query= CharProtDB::CH_004054 (397 letters) >FitnessBrowser__Koxy:BWI76_RS09870 Length = 396 Score = 330 bits (846), Expect = 4e-95 Identities = 169/397 (42%), Positives = 241/397 (60%), Gaps = 1/397 (0%) Query: 1 MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQP 60 MF+ + A DPIL L + F+ D R K+NL IG+Y +E G P L +V +AE L + Sbjct: 1 MFENITAAPADPILGLADLFRADDRPTKINLGIGVYKDETGKTPVLTSVKKAEQYL-LEN 59 Query: 61 HGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFP 120 YL ++G+ + LLFG ++ +R T QT GG+G L+V ADFL + Sbjct: 60 ETTKNYLSIDGIPEFGRCTQELLFGKGSAIINDKRARTAQTPGGTGGLRVAADFLAKNTD 119 Query: 121 ESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHP 180 +WVS+P+W NH ++F AG EV Y +YD A + + F+ LLA+L A +VL H Sbjct: 120 AKRIWVSNPSWPNHKSVFNSAGLEVREYTYYDAANHKLDFDGLLASLNEAQAGDVVLFHG 179 Query: 181 CCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPAL 240 CCHNPTG D T +QW + ++ + +P D AYQGF G+EEDA +RA A+ L Sbjct: 180 CCHNPTGIDPTLEQWQQLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAALHKELL 239 Query: 241 VSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLN 300 VS+S+SK F LY ERVG +++ D E R Q+K+ +R NYS+PP GA VVA +L+ Sbjct: 240 VSSSYSKNFGLYNERVGACTLVAADQETVDRAFSQMKSVIRANYSNPPAHGASVVATILS 299 Query: 301 DEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVD 360 ++AL+A W E+ +MR RI MR V L + R+F +++ Q GMFS++GL+ QV Sbjct: 300 NDALRAIWEQELTDMRQRIQRMRLLFVNTLQEKGASRDFSFIIQQNGMFSFSGLTKEQVL 359 Query: 361 RLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397 RLREEFG+Y +ASGR+ VAG+ N+ + +A AV+ Sbjct: 360 RLREEFGIYAVASGRINVAGMTPDNMAPLCEAIVAVL 396 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 396 Length adjustment: 31 Effective length of query: 366 Effective length of database: 365 Effective search space: 133590 Effective search space used: 133590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory