Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate BWI76_RS13120 BWI76_RS13120 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__Koxy:BWI76_RS13120 Length = 262 Score = 108 bits (269), Expect = 1e-28 Identities = 79/251 (31%), Positives = 122/251 (48%), Gaps = 13/251 (5%) Query: 16 TIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGADLKER----AT 71 T++ R N+ + M ++L + + DVR +++TGAG + FCAG DL +R + Sbjct: 17 TLNRPDRLNSFNDLMHQQLAACLKQAERDDDVRCLLLTGAG-RGFCAGQDLNDRNVDPSG 75 Query: 72 MAED---EVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAEL 128 A D V F + L R A+ K I A+NG A G G LAL CD+ +AA +A+ Sbjct: 76 PAPDLGLSVERFYNPLVRRLAALPKP---VICAVNGVAAGAGATLALGCDIVLAARSAKF 132 Query: 129 GLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLA 188 + KLG++P GG+ L R+ G RA L L ++A +A G+ ++ + L Sbjct: 133 VMAFSKLGLVPDCGGSWFLPRVAGRARAMGLALLGDSLSAEQAAQWGMIWQVVDDAELKD 192 Query: 189 VAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEIL-KTEDRLEGLRAF 247 LA + + K A+ LD L LE R Y+ + ++ D EG+ AF Sbjct: 193 TGLALARHLAAQPTYGLGLIKKALQLAETQTLDQQLDLE-RDYQRLAGRSADYREGVSAF 251 Query: 248 AEKRAPVYKGR 258 KR P + G+ Sbjct: 252 LAKRPPQFSGK 262 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 262 Length adjustment: 24 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory