Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate BWI76_RS05990 BWI76_RS05990 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQI0 (292 letters) >FitnessBrowser__Koxy:BWI76_RS05990 Length = 299 Score = 251 bits (640), Expect = 2e-71 Identities = 131/293 (44%), Positives = 197/293 (67%), Gaps = 5/293 (1%) Query: 3 LMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFIGYFLINSFQMNFF 62 + LQQ+VNG+ LG +YAL+A+GYTMVYG+++LINFAH D+ M+GAF FL +S + F Sbjct: 5 IFLQQVVNGMSLGGMYALIAIGYTMVYGVLRLINFAHADVMMVGAFTTLFLFSSIGLPFG 64 Query: 63 VALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLEYGMVYLVGANTRAF- 121 VA+ + + + G++I+ +AYRPLR +++I++LITAIGVSF LE L G ++R F Sbjct: 65 VAVFLTLALCGLFGMLIDRVAYRPLRQASKISMLITAIGVSFFLENLFNVLFGGSSRFFS 124 Query: 122 -PQAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTKMGKAMRAVSVDSDAAQL 180 P R G + +TNV ++ I+++L++ + ++ +T+ G A+RAV+ D + +L Sbjct: 125 APDFFNNTR-AFGDVIITNVAWIVPLITVLLLLAILWLLYRTRYGMAIRAVAFDVNTVRL 183 Query: 181 MGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLKSFVAAVLGGIGIIPG 240 MGI+ NR IS FALGS+LA GV ++ Y +++PLMGV GLK+F AAVLGGIG + G Sbjct: 184 MGIDANRIISLVFALGSSLAALGGVFYSISYPTIDPLMGVLIGLKAFAAAVLGGIGSVTG 243 Query: 241 AALGGFVIGLLETFATAF--GMSDFRDAIVYGILLLILIVRPAGILGKNVKEK 291 A LGGF++G E A A + ++DA + L+L+L+ RP GI+G E+ Sbjct: 244 AVLGGFILGFTEVVAVALFPELGGYKDAFAFMFLILVLLFRPVGIMGDERLER 296 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 299 Length adjustment: 26 Effective length of query: 266 Effective length of database: 273 Effective search space: 72618 Effective search space used: 72618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory