Align Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase; Pyr2C/Pip2C reductase; N-methyl-L-amino acid dehydrogenase; EC 1.5.1.21; EC 1.4.1.17 (characterized)
to candidate BWI76_RS07040 BWI76_RS07040 ureidoglycolate dehydrogenase
Query= SwissProt::Q4U331 (343 letters) >FitnessBrowser__Koxy:BWI76_RS07040 Length = 349 Score = 133 bits (334), Expect = 8e-36 Identities = 102/324 (31%), Positives = 145/324 (44%), Gaps = 10/324 (3%) Query: 13 VSYPQLIDLLRRIFVVHGTSPEVADVLAENCASAQRDGSHSHGIFRIPGYLSSLASGWVD 72 VS L L+ + G + AD++A+ A G HSHG R+ Y +A G + Sbjct: 3 VSRETLHQLIANKLNIAGLTHNHADIIADVLVYADARGIHSHGAVRVEYYAERIAKGGTN 62 Query: 73 GKAVPVVEDVGAAFVRVDACNGFAQPALAAARSLLIDKARSAGVAILAIRGSHHFAALWP 132 + E G + A N Q A I+ AR GVA++ IR H A+ Sbjct: 63 RQPNFTFEKTGPCSGILHADNAAGQVAAKMGMEHAIEIARENGVAVVGIRRMGHSGAISY 122 Query: 133 DVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFGAPRAGGEPIVFDLATSAIAH 192 V+ A G + LS+ S VVP G + +GTNP+AF AP G + I FD+AT+ A Sbjct: 123 FVQQAARAGFIGLSLCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDDIITFDMATTVQAW 182 Query: 193 GDVQIAAREGRLLPAGMGVDRDGLPTQEPRAILDGGALLPFGGHKGSALSMMVELLAAGL 252 G + A +P VD++G PT +P A+ ALLP G KG L MM+++L+ L Sbjct: 183 GKILDARSRHETIPDSWAVDKNGAPTSDPFAV---HALLPAAGPKGYGLMMMIDVLSGIL 239 Query: 253 TGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPD-KGAGQHFAQRSEELVRQLH------GV 305 F + +Q GQL IVI+P + F Q + +R+L+ G Sbjct: 240 LNLPFGRQVSSMYDNLSQGRELGQLHIVINPAFFSSSALFRQHISDTMRELNAIAPAPGF 299 Query: 306 GQERLPGDRRYLERARSMAHGIVI 329 Q PG + S GI I Sbjct: 300 NQVYYPGQNLDINEKNSAVDGIEI 323 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 349 Length adjustment: 29 Effective length of query: 314 Effective length of database: 320 Effective search space: 100480 Effective search space used: 100480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory