Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate BWI76_RS12840 BWI76_RS12840 amino acid ABC transporter permease/ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_05500 (242 letters) >FitnessBrowser__Koxy:BWI76_RS12840 Length = 506 Score = 130 bits (328), Expect = 4e-35 Identities = 79/219 (36%), Positives = 122/219 (55%), Gaps = 9/219 (4%) Query: 25 QGTWMTIKLSALSLLLSVLLGLLGASAKLSRVKLLRIPAQLYTTLIRGVPDLVLMLLIFY 84 Q TW IKLS L+ S++LG + A AK S KL PA+LY L R +P LVL++ + Y Sbjct: 19 QATWTVIKLSLLTWAFSIVLGFILALAKQSPRKLFNAPARLYIWLFRSMPLLVLLIFV-Y 77 Query: 85 SLQTWLTSFTDFMEWEYIEIDPFGAGVITLGFIYGAYFTETFRGAILAVPRGQVEAATAY 144 ++ L SF + DPF AG++ + AY E RG +L++P+GQ EAA A Sbjct: 78 NMPQALPSFAPVLN------DPFWAGLLAMVLSEAAYIAEIHRGGLLSIPKGQSEAARAL 131 Query: 145 GLK-RGQRFRFVVFPQMMRFALPGIGNNWMVMLKATALVSIIGLADLVKAAQDAGKSTYQ 203 GL+ G ++R VV PQ +R ALP + N ++ ++K ++LVS+I L +++ Q + Sbjct: 132 GLRYAGTQWR-VVIPQALRVALPALANEYIAIVKLSSLVSVISLTEILMVGQRLYSQNFL 190 Query: 204 LFYFLVLAALIYLLITSASNFILRWLERRYAAGAREAVR 242 + + A Y+LI + +F+L+ LE R+ R Sbjct: 191 VMETMAAVAFYYILIVTVFDFLLKRLETWLDVTQRKTTR 229 Lambda K H 0.329 0.142 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 506 Length adjustment: 29 Effective length of query: 213 Effective length of database: 477 Effective search space: 101601 Effective search space used: 101601 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory