Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate BWI76_RS26375 BWI76_RS26375 aspartate aminotransferase family protein
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__Koxy:BWI76_RS26375 Length = 421 Score = 258 bits (660), Expect = 2e-73 Identities = 145/407 (35%), Positives = 224/407 (55%), Gaps = 17/407 (4%) Query: 40 IERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFYENA 99 +E+ E ++D++GN DFA+G+ V+N GH HP+++ A+++Q + FTH + YE+ Sbjct: 26 VEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPKIIAAVEQQLQAFTHTAYQIVPYESY 85 Query: 100 IILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRTQAVL 159 + LAE++ LAP D K + +GAEA E A+K+ + TGR + F FHGRT + Sbjct: 86 VTLAERINALAPIDGPAKTAFFTTGAEAVENAVKIARAYTGRPGLITFGGGFHGRTFMTM 145 Query: 160 SLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYVFRHV 219 +LT + GF P V H YPN D + D + + Sbjct: 146 ALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGITTADAMKSLDRIFK-----------ADI 194 Query: 220 PPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGKFWAIE 279 ++ AI EPIQGEGG+ V P F +AL+ D +GILL DEVQ G RTGK +A++ Sbjct: 195 AADQVAAIVLEPIQGEGGFNVAPPEFMQALRALCDTHGILLIADEVQTGFARTGKLFAMQ 254 Query: 280 HFGVEPDLIQFGKAIGGGLPLAGVIHRADI-TFDKPGRHATTFGGNPVAIAAGIEVVEIV 338 H+ V+PDL+ K++ GG PL+GV+ RA++ PG T+ GNP+A+AA V++++ Sbjct: 255 HYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGNPLAVAAAHAVLDVI 314 Query: 339 KE--LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVKSKETKEKYPELRDR 396 +E L + +G +L + L + ++ I D RG G AVE +T E E+ + Sbjct: 315 EEEQLCQRAERLGSHLKEVLNQARQSCPAIADVRGQGSMVAVEF-NDPQTGEPSAEITRQ 373 Query: 397 IVKESAKRGLVLLGCG--DNSIRFIPPLIVTKEEIDVAMEIFEEALK 441 I +++ + GL+LL CG N IRF+ PL + + A++I LK Sbjct: 374 IQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVLK 420 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 421 Length adjustment: 32 Effective length of query: 413 Effective length of database: 389 Effective search space: 160657 Effective search space used: 160657 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory