GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lysN in Klebsiella michiganensis M5al

Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate BWI76_RS14020 BWI76_RS14020 aspartate aminotransferase family protein

Query= reanno::Putida:PP_4108
         (416 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS14020 BWI76_RS14020 aspartate
           aminotransferase family protein
          Length = 461

 Score =  198 bits (504), Expect = 2e-55
 Identities = 142/426 (33%), Positives = 216/426 (50%), Gaps = 42/426 (9%)

Query: 15  PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATR--LTHYAFNAA 72
           P+ ++      + D D K+Y+D + G G L LGH +P V+++IQ+  T     H      
Sbjct: 42  PLAITKAEGVWLTDADNKQYLDCLAGAGTLALGHNHPDVLQSIQSVITSGLPLHTLDLTT 101

Query: 73  PHGPYLALMEQLSQFVPVSYPLAG------MLTNSGAEAAENALKVARGATGKRAIIAFD 126
           P      L ++ S+++    P  G          SGA+A E ALK+A+  TG+ ++I+F 
Sbjct: 102 P------LKDRFSEYLLSLLPGEGKEYCLQFTGPSGADAVEAALKLAKKYTGRSSVISFS 155

Query: 127 GGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPS---ADTGVTCEQALKAMDRLFS 183
           GG+HG T   L++ G ++P     G +P  V  +PYP       G+  E  +KA+   F 
Sbjct: 156 GGYHGMTHGALSVTGNLSPKAAVNGMMP-EVQFMPYPHQYRCPLGIGGEAGVKALTYYFE 214

Query: 184 -----VELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGR 238
                VE  V   AA I E VQGEGG       + Q +R+   E GIL+IIDE+Q+GF R
Sbjct: 215 NLINDVESGVRKPAAVILEAVQGEGGVNPAPVEWLQRIRKVTQEHGILLIIDEVQAGFAR 274

Query: 239 TGQRFAFPRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAA 298
           TG+ FAF   GIEPD+++++K++ GG+PL AV+G K+   A   G   GT+ GN ++ A 
Sbjct: 275 TGKFFAFEHAGIEPDIIVMSKAVGGGLPL-AVLGIKKQFDAWEPGHHTGTFRGNQLAMAT 333

Query: 299 ALASLAQMTDENL----ATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFAN 354
            L +L  + D  +    A  GE  +  +    +R+      P IG + G+G M GIE   
Sbjct: 334 GLTTLRHLKDNKIADKTAAQGEWLKGKLAEMQKRY------PVIGHVRGLGLMIGIEIVK 387

Query: 355 ADGS-------PAPAQLAKVME-AARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLD 406
            + +       PA  +L+ +++      GL+L   G+   ++RLL  L I    LE   D
Sbjct: 388 PNEAPDHMGCYPADGELSALLQKKCFEAGLILERGGRHGCVLRLLPSLLISNAELEIFFD 447

Query: 407 ILEQCL 412
             EQ L
Sbjct: 448 KFEQAL 453


Lambda     K      H
   0.320    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 502
Number of extensions: 22
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 416
Length of database: 461
Length adjustment: 32
Effective length of query: 384
Effective length of database: 429
Effective search space:   164736
Effective search space used:   164736
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory