Align lysine-specific permease (characterized)
to candidate BWI76_RS01140 BWI76_RS01140 amino acid permease
Query= CharProtDB::CH_003129 (489 letters) >FitnessBrowser__Koxy:BWI76_RS01140 Length = 461 Score = 306 bits (784), Expect = 1e-87 Identities = 170/435 (39%), Positives = 255/435 (58%), Gaps = 17/435 (3%) Query: 7 TTEAPGLRRELKARHLTMIAIGGSIGTGLFVASGATISQAGPGGALLSYMLIGLMVYFLM 66 T + L+R L+ARH+ +IA+GG+IG GLF+ + +T+ AGP LL+Y++ GL V+F+M Sbjct: 2 TEKKAELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPS-VLLAYIIAGLFVFFIM 60 Query: 67 TSLGELAAYMPVSGSFATYGQNYVEEGFGFALGWNYWYNWAVTIAVDLVAAQLVMSWWFP 126 S+GE+ PV+GSFA Y Y+ FG+ W+YW+ W ++ A + + +WFP Sbjct: 61 RSMGEMLFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFP 120 Query: 127 DTPGWIWSALFLGVIFLLNYISVRGFGEAEYWFSLIKVTTVIVFIIVGV-LMIIGIFKGA 185 + WI + + +G++ L N +VR +GE E+WF++IKVTT+IV I+VG+ ++ G G Sbjct: 121 EMAQWIPALIAVGLVALANLAAVRLYGEIEFWFAMIKVTTIIVMIVVGLGVIFFGFGNGG 180 Query: 186 QPAGWSNWTIGEAPFAGGFAAMIGVAMIVGFSFQGTELIGIAAGESEDPAKNIPRAVRQV 245 G+ N T FAGG+ + IV S+QG ELIGI AGE+++P + AV +V Sbjct: 181 HAIGFGNLTEHGGFFAGGWKGFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKV 240 Query: 246 FWRILLFYVFAILIISLIIPYTDPSLLRNDVKDISVSPFTLVFQHAGLLSAAAVMNAVIL 305 WRIL+FYV AI +I I P+ D + SPF L F G+ +AA ++N V+L Sbjct: 241 LWRILIFYVGAIFVIVTIFPW--------DQIGSNGSPFVLTFAKIGITAAAGIINFVVL 292 Query: 306 TAVLSAGNSGMYASTRMLYTLACDGKAPRIFAKLSRGGVPRN--ALYATTVIAGLCFLTS 363 TA LS NSGMY+ RMLY LA + + P AK+SR GVP AL ++ G C Sbjct: 293 TAALSGCNSGMYSCGRMLYALARNRQLPAAIAKVSRNGVPSAGVALSILILLVGSCLNYI 352 Query: 364 MFGNQTVYLWLLNTSGMTGFIAWLGIAISHYRFRRGYVLQGHDINDLPYRSGFFPLGP-- 421 + Q V++++ + S + G + W I IS RFR ++ + P+RS FP Sbjct: 353 IPNPQRVFVYVYSASVLPGMVPWFVILISQLRFR---LVHKEAMASHPFRSLLFPWANYL 409 Query: 422 IFAFILCLIITLGQN 436 AF++C++I +G N Sbjct: 410 TMAFLVCVLIGMGFN 424 Lambda K H 0.327 0.142 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 741 Number of extensions: 57 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 489 Length of database: 461 Length adjustment: 33 Effective length of query: 456 Effective length of database: 428 Effective search space: 195168 Effective search space used: 195168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory