Align Probable lysine/arginine permease CAN2; Basic amino acids permease CAN2 (characterized)
to candidate BWI76_RS04870 BWI76_RS04870 aromatic amino acid transporter AroP
Query= SwissProt::Q59WU0 (568 letters) >FitnessBrowser__Koxy:BWI76_RS04870 Length = 455 Score = 234 bits (598), Expect = 4e-66 Identities = 152/471 (32%), Positives = 250/471 (53%), Gaps = 43/471 (9%) Query: 55 DEVKRDLKARHVSMIAIGGTIGTGLFISTGSLLHTTGPVMSLISFLFVTTLAYSVTQSLG 114 D +KR LK RH+ +IA+GG IGTGLF+ + S++ GP + ++ + +A+ + + LG Sbjct: 8 DRLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQNAGPGI-ILGYAIAGFIAFLIMRQLG 66 Query: 115 EMTTYIPVSGSFAQFITRWVSKSCGAANGWLYWFSWAITFALELSVVGQVIQYWTDAVPL 174 EM PV+GSF+ F ++ G A+GW YW + + EL+ VG+ +Q+W +P Sbjct: 67 EMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYVLVAMAELTAVGKYVQFWWPEIPT 126 Query: 175 AGWIS--IFFVLLTTFNLFPVKYYGEVEFWIASTKVIAIV------GWLIYAFCMVCGAG 226 W+S IFF+ + NL VK +GE+EFW A KV+A+V GWL++ +G Sbjct: 127 --WVSAAIFFIAINAINLTNVKVFGEMEFWFAIIKVVAVVAMILFGGWLLF-------SG 177 Query: 227 KTGPVGFRYWRNGYAWGDGMIVSNNGKYAISFINGLINAVFTFQGTELVAVTAGEAS--P 284 GP RN W G + +G + + +I +F+F G ELV +TA EA Sbjct: 178 NGGPQA--TVRN--LWEQGGFLP-HGFTGLVMMMAII--MFSFGGLELVGITAAEADNPE 230 Query: 285 RAIRSAIKKVMFRILVFYVLCMLFIGLLVPYNDPKLTQDGGFTRNSPFLIAMENSGTKVL 344 ++I A +V++RIL+FYV + + L+P++ ++T D SPF++ G + Sbjct: 231 QSIPKATNQVIYRILIFYVGSLAVLLSLLPWS--RVTAD-----TSPFVLIFHELGDTFV 283 Query: 345 PHIFNAVIVTTIISAGNSNVYSGSRILYGLAQAGVAPKFFLKTNKGGVPYFAVLFTAAFG 404 + N V++T +S NS VY SR+L+GLAQ G APK + +K GVP +L +A Sbjct: 284 ANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALMSVDKRGVPVNTILVSALVT 343 Query: 405 ALGYLACSEDGNKAFTWLLNIIATAGLIAWGFISVSHVRFMNVLRKRGLSRDILPYKAFF 464 AL L AF L+ ++ +A +I W IS++H++F +++G+ + + A Sbjct: 344 ALCVLINYFAPESAFGLLMALVVSALVINWAMISLAHIKFRRAKQQQGV---VTRFPALL 400 Query: 465 MPYSAYYAIIIIFIVVLIQGFTVFWDFNASDFFTAYISVILFVVLWIGFHF 515 P S + ++ + V++I T + Y+ + VL +G+ F Sbjct: 401 YPLSNWICLLFMAGVLVIMLMT------PGMAISVYLIPVWIAVLGVGYLF 445 Lambda K H 0.326 0.141 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 765 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 568 Length of database: 455 Length adjustment: 34 Effective length of query: 534 Effective length of database: 421 Effective search space: 224814 Effective search space used: 224814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory